Report for 1902.m00210

 > 1902.m00210, length: 1094, copies: 1 

MAIGLPVWISVALLIALSIVASASSLGLSKSNGSDTDLAALLALKVHFSDPDNILAGNWTAGTPFCQWVGVSCSR

HRQRVTALELPGIPLQGELGPHLGNISFLSVLNLTDTGLTGSVPDDIGRLHRLKLIDLGHNALSGGIPATIGNLM

RLQLLHLPSNQLSGPIPIELQALRRLRSIDLIGNYLTGSIPDSLFNNTPLLAYLSIGNNSLSGPIPGCIGSLPML

ELLELQYNNLTGPVPQAIFNMSRLTVVDLGFNSLTGSIPGNTSFSLPVLQWFSISHNRFTGQIPPGLAACPYLQV

LRVGDNLFEGVFPSWLAKSTNLSDVSLSRNHLDAGPIPAALSNLTMLTRLGLEMCNLIGAIPVGIGQLGQLSVLD

LTTNQLTGPIPACLGNLSALTILSLAENQLDGSVPATIGNMNSLKQLSIAQNNLQGDIGYFLSILSNCINLSTLY

IYSNHFTGSLPGSVGNLSSLLRVFSAFENSFTGELPAMISNLTGIQVLDLGGNQLHGKIPESIMMMRNLVFLNLE

TNNLSGSIPLNTGMLNNIELIYIGTNKFSGLQLDPSNLTKLEHLALGHNQLSSTVPPSLFHLDRLILLDLSQNFF

SGELPVDIGNIKQINYMDIYMNRFVGSLPDSIGHLQMLGYLNLSVNEFHDSIPDSFSNLSGLQILDISHNNISGT

IPKYLANFTSLANLNLSFNKLEGQIPEGGVFSNITLQSLAGNSGLCGVVRLGFSPCQTTSPKRNRHILKYILLPG

IIIVVAAVTCCLYGIIRKKVKHQNISSGMLDMISHQLLSYHELVRATDNFSEDNMLGSGSFGKVFKGQLSSGLVV

AIKVIHNHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLEFRALVLQYMPQGSLEALLHSEERMQLGFLERLD

IMLDVSMAMEYLHHEHYEVVVHCDLKPSNVLFDDEMTAHVADFGIARLLLGDDNSTISASMPGTIGYMAPEYGVL

GKASRKSDVFSYGIMLLEVFTRKRPTDAMFVGDLSIRQWVHWAFPIDLVHVVDGQLLQDTSCSTSSIDGFLKPVF

ELGLLCSADSPEQRMEMKDVVVMLKKIRKDYVKSTAKTGSNAQQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	5
LRR [Pfam ls]	127	150	0.47
LRR [Pfam ls]	151	174	5.4
LRR [Pfam ls]	175	199	0.061
LRR [Pfam ls]	200	223	3.2
LRR [Pfam ls]	224	247	0.44
LRR [Pfam ls]	248	272	0.41
LRR [Pfam ls]	273	296	3.3
LRR [Pfam ls]	321	345	3.8
LRR [Pfam ls]	370	393	0.54
LRR [Pfam ls]	445	468	0.25
LRR [Pfam ls]	494	517	5.2
LRR [Pfam ls]	565	588	0.75
LRR [Pfam ls]	589	612	1.8
LRR [Pfam ls]	637	660	6.4
LRR [Pfam ls]	661	684	0.0036
LRR [Pfam ls]	685	707	1.3
Ser/Thr pkinase [Pfam fs]	800	1002	1.1e-49
Ser/Thr pkinase [Pfam ls]	800	1074	7.7e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	126	0.21
LRR [sensitive, ls]	103	126	5
LRR [sensitive, ls]	127	150	0.02
LRR [sensitive, ls]	127	150	0.47
LRR [sensitive, ls]	151	174	0.23
LRR [sensitive, ls]	151	174	5.4
LRR [sensitive, ls]	175	199	0.0026
LRR [sensitive, ls]	175	199	0.061
LRR [sensitive, ls]	200	223	0.14
LRR [sensitive, ls]	200	223	3.2
LRR [sensitive, ls]	224	247	0.019
LRR [sensitive, ls]	224	247	0.44
LRR [sensitive, ls]	248	272	0.018
LRR [sensitive, ls]	248	272	0.41
LRR [sensitive, ls]	273	296	0.14
LRR [sensitive, ls]	273	296	3.3
LRR [sensitive, ls]	297	320	0.74
LRR [sensitive, ls]	297	320	17
LRR [sensitive, ls]	321	345	0.16
LRR [sensitive, ls]	321	345	3.8
LRR [sensitive, ls]	370	393	0.023
LRR [sensitive, ls]	370	393	0.54
LRR [sensitive, ls]	394	417	0.5
LRR [sensitive, ls]	394	417	12
LRR [sensitive, ls]	418	441	0.78
LRR [sensitive, ls]	418	441	18
LRR [sensitive, ls]	445	468	0.011
LRR [sensitive, ls]	445	468	0.25
LRR [sensitive, ls]	470	493	1.7
LRR [sensitive, ls]	470	493	40
LRR [sensitive, ls]	494	517	0.22
LRR [sensitive, ls]	494	517	5.2
LRR [sensitive, ls]	518	541	0.53
LRR [sensitive, ls]	518	541	12
LRR [sensitive, ls]	542	564	0.45
LRR [sensitive, ls]	542	564	11
LRR [sensitive, ls]	565	588	0.032
LRR [sensitive, ls]	565	588	0.75
LRR [sensitive, ls]	589	612	0.077
LRR [sensitive, ls]	589	612	1.8
LRR [sensitive, ls]	613	636	3.8
LRR [sensitive, ls]	613	636	87
LRR [sensitive, ls]	637	660	0.27
LRR [sensitive, ls]	637	660	6.4
LRR [sensitive, ls]	661	684	0.00015
LRR [sensitive, ls]	661	684	0.0036
LRR [sensitive, ls]	685	707	0.056
LRR [sensitive, ls]	685	707	1.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	19	721	1e-58
FLS2 [A.thaliana]	25	410	1e-50
FLS2 [A.thaliana]	35	701	3e-91
Cf-9 [L. pimpinellifolium]	58	722	2e-63
FLS2 [A.thaliana]	78	269	6e-26
FLS2 [A.thaliana]	83	1078	1e-153
Xa21 [O. sativa]	204	892	1e-111
CLV2 [A. thaliana]	350	725	2e-34
FLS2 [A.thaliana]	357	717	1e-49
Cf-9 [L. pimpinellifolium]	422	729	4e-15
FLS2 [A.thaliana]	569	702	4e-12
Xa21 [O. sativa]	586	718	1e-12
Rpg1 [Hordeum vulgare]	777	998	2e-25
Pto [L. esculentum]	792	1075	1e-29
Rpg1 [Hordeum vulgare]	797	998	2e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	7	29	in -> out
putative TM domain	745	767	out -> in
putative TM domain	745	767	out -> in

Report for 1902.m00210

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)