Report for 1940.m00164

 > 1940.m00164, length: 920, copies: 1 

MPPTLLLLLLLLPPSLASPDRDIYALAKLKAALVPSPSATAPPPLADWDPAATSPAHCTFSGVTCDGRSRVVAIN

LTALPLHSGYLPPEIALLDSLANLTIAACCLPGHVPLELPTLPSLRHLNLSNNNLSGHFPVPDYRRYGDLAALEY

LGLNGNTLSGHVPVSLSRLTRLREMYIGYYNQYDGGVPPEFGDLGALLRLDMSSCNLTGPVPPELGRLQRLDTLF

LQWNRLSGEIPPQLGDLSSLASLDLSVNDLAGEIPPSLANLSNLKLLNLFRNHLRGSIPDFVAGFAQLEVLQLWD

NNLTGNIPAGLGKNGRLKTLDLATNHLTGPIPADLCAGRRLEMLVLMENGLFGPIPDSLGDCKTLTRVRLAKNFL

TGPVPAGLFNLPQANMVELTDNLLTGELPDVIGGDKIGMLLLGNNGIGGRIPPAIGNLPALQTLSLESNNFSGAL

PPEIGNLKNLSRLNVSGNALTGAIPDELIRCASLRRRRPQPNRLTGELPPEMSNMTSLTTLDVSYNSLSGPVPMQ

GQFLVFNESSFVGNPGLCGGPVADACPPSMAGGGGGAGSQLRLRWDSKKMLVALVAAFAAVAVAFLGARKGCSAW

RSAARRRSGAWKMTAFQKLEFSAEDVVECVKEDNIIGKGGAGIVYHGVTRGAELAIKRLVGRGGGEHDRGFSAEV

TTLGRIRHRNIVRLLGFVSNRETNLLLYEYMPNGSLGEMLHGGKGGHLGWEARARVAAEAACGLCYLHHDCAPRI

IHRDVKSNNILLDSAFEAHVADFGLAKFLGGATSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELIT

GRRPVGGFGDGVDIVHWVRKVTAELPDNSDTAAVLAVADRRLTPEPVALMVNLYKVAMACVEEASTARPTMREVV

HMLSNPNSAQPNSGDLLVTF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	141	0.44
LRR [Pfam ls]	147	170	1.7
LRR [Pfam ls]	196	219	6.3
LRR [Pfam ls]	220	243	0.67
LRR [Pfam ls]	244	267	0.25
LRR [Pfam ls]	268	291	0.99
LRR [Pfam ls]	292	315	1.1
LRR [Pfam ls]	411	434	4.7
LRR [Pfam ls]	435	458	0.099
LRR [Pfam ls]	459	483	0.08
Ser/Thr pkinase [Pfam fs]	630	829	2e-43
Ser/Thr pkinase [Pfam ls]	630	905	1.6e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	119	141	0.019
LRR [sensitive, ls]	119	141	0.44
LRR [sensitive, ls]	147	170	0.071
LRR [sensitive, ls]	147	170	1.7
LRR [sensitive, ls]	196	219	0.27
LRR [sensitive, ls]	196	219	6.3
LRR [sensitive, ls]	220	243	0.029
LRR [sensitive, ls]	220	243	0.67
LRR [sensitive, ls]	244	267	0.011
LRR [sensitive, ls]	244	267	0.25
LRR [sensitive, ls]	268	291	0.042
LRR [sensitive, ls]	268	291	0.99
LRR [sensitive, ls]	292	315	0.046
LRR [sensitive, ls]	292	315	1.1
LRR [sensitive, ls]	316	339	0.49
LRR [sensitive, ls]	316	339	11
LRR [sensitive, ls]	340	363	0.85
LRR [sensitive, ls]	340	363	20
LRR [sensitive, ls]	364	387	0.48
LRR [sensitive, ls]	364	387	11
LRR [sensitive, ls]	411	434	0.2
LRR [sensitive, ls]	411	434	4.7
LRR [sensitive, ls]	435	458	0.0043
LRR [sensitive, ls]	435	458	0.099
LRR [sensitive, ls]	459	483	0.0034
LRR [sensitive, ls]	459	483	0.08
LRR [sensitive, ls]	507	528	0.48
LRR [sensitive, ls]	507	528	11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	716	3e-65
FLS2 [A.thaliana]	22	523	3e-71
Cf-9 [L. pimpinellifolium]	54	523	2e-40
CLV2 [A. thaliana]	61	477	5e-41
CLV2 [A. thaliana]	83	455	2e-20
FLS2 [A.thaliana]	83	900	1e-96
Cf-9 [L. pimpinellifolium]	95	551	2e-51
CLV2 [A. thaliana]	95	554	3e-43
CLV2 [A. thaliana]	98	523	4e-48
CLV2 [A. thaliana]	151	524	4e-43
FLS2 [A.thaliana]	245	529	1e-34
CLV2 [A. thaliana]	247	525	4e-25
Pto [L. esculentum]	615	903	3e-33
Rpg1 [Hordeum vulgare]	624	905	9e-28
Rpg1 [Hordeum vulgare]	626	919	7e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 1940.m00164

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)