Report for 1947.m00141

 > 1947.m00141, length: 1064, copies: 1 

MAHRGDRFLVVVVVVVVLGVVVRPAAALSADGKALLSLLPAAAPSPVLPSWDPTAATPCSWQGVTCSPQSRVVSL

SLPNTFLNLSSLPPQLASLSSLQLLNLSTCNISGAIPPAYASLAALRVLDLSSNALYGDIPASLGALSGLQYLLL

NSNRLTGAIPRSLASLAALQVLCVQDNLLNGTIPASLGALTALQQFRVGGNPGLSGPIPASLGALSNLTVFGAAA

TALSGAIPEELGNLANLQTLALYDTGVSGPIPAALGGCAELRNLYLHMNKLTGPIPPELGRLQKLTSLLLWGNAL

SGRIPPELSNCSALVVLDLSGNRLAGEVPGALGRLAALEQLHLSDNQLAGRIPAELSNCSSLTALQLDKNGLTGA

IPPQLGELRALQVLFLWGNALSGAIPPSLGNCTELYALDLSRNRLAGGIPDEVFALQKLSKLLLLGNALSGRLPP

SVADCSSLVRLRLGENQLAGEIPREIGKLPNLVFLDLYSNKFTGALPGELANITVLELLDVHNNSFTGAIPPQFG

ELMNLEQLDLSMNKLTGEIPASFGNFSYLNKLILSGNMLSGTLPKSIRNLQKLTMLELSNNSFSGPIPPEIGALS

SLSISLDLSSNRFTGELPDEMSSLTQLQSLDLSSNGLYGSISVLSGLTSLTSLNISYNNFSGAIPVTPFFKTLSS

SSYINNPNLCESYDGHTCASDMVRRTALKTVKTVILVCAVLGSITLLLVVVWILINRSRTLAGKKAMSMSVAGGD

DFSHPWTFTPFQKLNFCVDNILECLRDENVIGKGCSGVVYRAEMPNGEIIAVKKLWKTSKEEPIDAFAAEIQILG

HIRHRNIVKLLGYCSNKYVKLLLYNYIPNGNLQQLLKDNRSLDWDTRYKIAVGAAQGLAYLHHDCVPAILHRDVK

CNNILLDTKYEAYLADFGLAKLMNSPNYHHAMSRIAEYGYTTKITEKSDVYSYGVVLLEILSGRSAVEAVVGDSL

HIVEWAKKKMGSYEPAVNILDPKLRGMPDQLVQEMLQTLGIAIFCVNPAPAERPTMKEVVAFLKEVKCSPEEWGK

ISQQPLIKPGSQQG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	96	119	0.7
LRR [Pfam ls]	120	143	0.19
LRR [Pfam ls]	144	167	0.88
LRR [Pfam ls]	168	191	5.7
LRR [Pfam ls]	241	264	6.9
LRR [Pfam ls]	265	288	7.4
LRR [Pfam ls]	289	312	0.16
LRR [Pfam ls]	313	336	0.66
LRR [Pfam ls]	337	360	0.15
LRR [Pfam ls]	361	384	0.91
LRR [Pfam ls]	385	408	0.4
LRR [Pfam ls]	409	432	2
LRR [Pfam ls]	457	480	0.82
LRR [Pfam ls]	481	504	0.12
LRR [Pfam ls]	505	528	1.1
LRR [Pfam ls]	529	552	0.035
LRR [Pfam ls]	553	576	0.67
LRR [Pfam ls]	577	600	0.12
LRR [Pfam ls]	626	648	0.07
LRR [Pfam ls]	649	671	2.4
Ser/Thr pkinase [Pfam fs]	775	963	4.9e-41
Ser/Thr pkinase [Pfam ls]	775	1038	2.5e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	71	95	1.9
LRR [sensitive, ls]	71	95	44
LRR [sensitive, ls]	96	119	0.03
LRR [sensitive, ls]	96	119	0.7
LRR [sensitive, ls]	120	143	0.0082
LRR [sensitive, ls]	120	143	0.19
LRR [sensitive, ls]	144	167	0.038
LRR [sensitive, ls]	144	167	0.88
LRR [sensitive, ls]	168	191	0.24
LRR [sensitive, ls]	168	191	5.7
LRR [sensitive, ls]	192	216	1.4
LRR [sensitive, ls]	192	216	32
LRR [sensitive, ls]	241	264	0.29
LRR [sensitive, ls]	241	264	6.9
LRR [sensitive, ls]	265	288	0.32
LRR [sensitive, ls]	265	288	7.4
LRR [sensitive, ls]	289	312	0.007
LRR [sensitive, ls]	289	312	0.16
LRR [sensitive, ls]	313	336	0.028
LRR [sensitive, ls]	313	336	0.66
LRR [sensitive, ls]	337	360	0.0062
LRR [sensitive, ls]	337	360	0.15
LRR [sensitive, ls]	361	384	0.039
LRR [sensitive, ls]	361	384	0.91
LRR [sensitive, ls]	385	408	0.017
LRR [sensitive, ls]	385	408	0.4
LRR [sensitive, ls]	409	432	0.087
LRR [sensitive, ls]	409	432	2
LRR [sensitive, ls]	433	456	2.1
LRR [sensitive, ls]	433	456	49
LRR [sensitive, ls]	457	480	0.035
LRR [sensitive, ls]	457	480	0.82
LRR [sensitive, ls]	481	504	0.0053
LRR [sensitive, ls]	481	504	0.12
LRR [sensitive, ls]	505	528	0.046
LRR [sensitive, ls]	505	528	1.1
LRR [sensitive, ls]	529	552	0.0015
LRR [sensitive, ls]	529	552	0.035
LRR [sensitive, ls]	553	576	0.029
LRR [sensitive, ls]	553	576	0.67
LRR [sensitive, ls]	577	600	0.0053
LRR [sensitive, ls]	577	600	0.12
LRR [sensitive, ls]	602	625	1.4
LRR [sensitive, ls]	602	625	32
LRR [sensitive, ls]	626	648	0.003
LRR [sensitive, ls]	626	648	0.07
LRR [sensitive, ls]	649	671	0.11
LRR [sensitive, ls]	649	671	2.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	8	1042	1e-139
Xa21 [O. sativa]	48	861	2e-86
Cf-9 [L. pimpinellifolium]	50	665	1e-54
CLV2 [A. thaliana]	60	693	8e-67
Cf-9 [L. pimpinellifolium]	87	401	7e-29
Cf-9 [L. pimpinellifolium]	91	684	2e-66
Rpg1 [Hordeum vulgare]	699	1044	1e-18
Pto [L. esculentum]	761	1035	6e-38
Rpg1 [Hordeum vulgare]	768	1041	2e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	7	29	in -> out
putative TM domain	708	730	out -> in
putative TM domain	708	730	out -> in

Report for 1947.m00141

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)