Report for 1950.m00137

 > 1950.m00137, length: 1002, copies: 3 

MACLGVLSSGIVWLCLSIIFMILPIAISDEHENDRQALLCFKSQLSGPPGVLASWSNASQEFCNWHGVTCSTPSP

RRVTAIDLASEGISGSISPCIANLTSLTMLQLSNNSFNGSIPSVLGLLGQLNNLNLSMNSLEGNIPSELSSCSQL

EILDLSNNFIQGEIPASLSQCNRLKKIHLSKNKLQGRIPYAFGNLPKLEKVVLASNRLTGDIPASLGSSLSLTYV

NLESNALTGSIPQSLLNSSSLKVLVLTRNTLTGEIPKPLFTSSTLTDIYLDENNFVGSIPHVTATPLPLQYLYLG

GNKLSGTIPSSLGNLSSLLDLSLTRNNLTGSIPDSLGHIPTLELLNLNVNKLTGHVPSSIFNLSSLKSLAMANNS

LTGELPSNLGYTLPNIKTLILSNNRFKGPIPPTLVNASNLKSLYLRNNSLTGLIPFFGSLLNLEEVMLSYNKLEA

ADWSFISSLSNCSKLTKLLIDGNNLKGNIPPAIGNLNNLVVLAMAQNNLSGQIPDTIGNLVKLTDLKLSGNIPSS

LGKCVALESLEMQSNLLVGSIPKSFEKLVGIWNMDISQNNLTGKIPDFLSNFSLLYDLNLSFNNFEGEVPAGGIF

RNASVVSIEGNNGLCARTSMGGIPLCSVQVHRNRRHKSLVLVLMIVIPIVSITIILLSFAAFFWRKRMQVTPKLP

QCNEHVFKNITYENIAKATNKFSSDNLIGSGSFAMVYKGNLELQEDEVAIKIFNLGTYGAHRGFIAECETLRNVR

HRNLVKIITLCSSVDATGADFKALVFQYMQNGNLDTWLHPKSQELSQGKVLTISQRVNIALDVAFALDYLHNQCA

TPLIHCDLKPSNILLDLDMVAYVSDFGLARFVYNRLTAHEDTSTSLACLKGSIGYIPPEYGMRKDISTKGDVYSF

GILLLEIIIGSRPTDEKFNGSTTLHEFVHGAFPNNIYEVVDPTMLQNDLVATDVMENCIIPLVKIGLCCSVPLPN

ERPEMGQVATMILEIKHAASNRHVRLS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	101	124	0.51
LRR [Pfam ls]	149	172	0.0098
LRR [Pfam ls]	173	196	0.026
LRR [Pfam ls]	221	244	2.1
LRR [Pfam ls]	245	269	0.62
LRR [Pfam ls]	293	316	0.043
LRR [Pfam ls]	317	340	0.66
LRR [Pfam ls]	341	364	1.9
LRR [Pfam ls]	365	389	2.6
LRR [Pfam ls]	390	413	3.2
LRR [Pfam ls]	414	436	0.013
LRR [Pfam ls]	437	460	5.1
LRR [Pfam ls]	464	487	0.085
LRR [Pfam ls]	488	511	6.3
LRR [Pfam ls]	531	554	2.2
Ser/Thr pkinase [Pfam fs]	697	916	7.8e-42
Ser/Thr pkinase [Pfam ls]	697	987	2.7e-36

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	101	124	0.022
LRR [sensitive, ls]	101	124	0.51
LRR [sensitive, ls]	125	148	0.5
LRR [sensitive, ls]	125	148	12
LRR [sensitive, ls]	149	172	0.00042
LRR [sensitive, ls]	149	172	0.0098
LRR [sensitive, ls]	173	196	0.0011
LRR [sensitive, ls]	173	196	0.026
LRR [sensitive, ls]	197	220	0.68
LRR [sensitive, ls]	197	220	16
LRR [sensitive, ls]	221	244	0.091
LRR [sensitive, ls]	221	244	2.1
LRR [sensitive, ls]	245	269	0.027
LRR [sensitive, ls]	245	269	0.62
LRR [sensitive, ls]	293	316	0.0019
LRR [sensitive, ls]	293	316	0.043
LRR [sensitive, ls]	317	340	0.028
LRR [sensitive, ls]	317	340	0.66
LRR [sensitive, ls]	341	364	0.081
LRR [sensitive, ls]	341	364	1.9
LRR [sensitive, ls]	365	389	0.11
LRR [sensitive, ls]	365	389	2.6
LRR [sensitive, ls]	390	413	0.14
LRR [sensitive, ls]	390	413	3.2
LRR [sensitive, ls]	414	436	0.00054
LRR [sensitive, ls]	414	436	0.013
LRR [sensitive, ls]	437	460	0.22
LRR [sensitive, ls]	437	460	5.1
LRR [sensitive, ls]	464	487	0.0037
LRR [sensitive, ls]	464	487	0.085
LRR [sensitive, ls]	488	511	0.27
LRR [sensitive, ls]	488	511	6.3
LRR [sensitive, ls]	531	554	0.095
LRR [sensitive, ls]	531	554	2.2
LRR [sensitive, ls]	555	578	0.38
LRR [sensitive, ls]	555	578	8.8
LRR [sensitive, ls]	579	604	0.86
LRR [sensitive, ls]	579	604	20

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	13	596	1e-101
CLV2 [A. thaliana]	23	618	6e-60
Xa21 [O. sativa]	34	808	1e-137
Cf-9 [L. pimpinellifolium]	54	595	1e-52
Cf-9 [L. pimpinellifolium]	76	427	6e-36
FLS2 [A.thaliana]	81	521	6e-58
Cf-9 [L. pimpinellifolium]	88	614	5e-55
FLS2 [A.thaliana]	88	996	1e-131
Cf-9 [L. pimpinellifolium]	239	634	7e-33
Cf-9 [L. pimpinellifolium]	345	612	9e-18
Rpg1 [Hordeum vulgare]	683	980	5e-26
Pto [L. esculentum]	688	983	1e-24
Rpg1 [Hordeum vulgare]	694	910	7e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	5	27	in -> out
putative TM domain	642	664	out -> in
putative TM domain	642	664	out -> in

Report for 1950.m00137

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)