Report for 1950.m00140

 > 1950.m00140, length: 1080, copies: 3 

MACLGVLSSGIVWLSLFTIFVSIPLATSDDHENDRQTLLCFKSQLSGPTGVLDSWSNASLEFCSWHGVTCSTQSP

RRVASIDLASEGISGFISPCIANLTFLTRLQLSNNSFHGSIPSELGLLSQLNTLNLSTNALEGNIPSELSSCSQL

EILDLSNNFIQGEIPASLSQCNHLKDIDLSKNKLKGMIPSDFGNLPKMQIIVLASNRLTGDIPPSLGSGHSLTYV

DLGSNDLTGSIPESLVNSSSLQVLVLTSNTLSGELPKALFNSSSLIAIYLDENSFVGSIPPATAISLPLKYLYLG

GNKLSGTIPSSLGNLSSLLDLSLTRNNLVGNVPDSLGLIPKLDLLNLNANNLIGHVPSSIFNMSSLTILTMANNS

LIGELPSNLGYTLPNIETLVLSNNRFKGFIPPTLLNASDLSLLYMRNNSLTGLIPFFGSLKNLKELMLSYNKLEA

ADWSFISSLSNCSKLTKLLIDGNNLKGKLPHSIGNLSSSLKWLWIRDNKISGNIPPEIGNLKSLEMLYMDYNLLT

GDIPPTIGNLHNLVVLAIAQNKLSGQIPDTIGNLVKLTDLKLDRNNFSGGIPVTLEHCTQLEILNLAHNSLDGRI

PNQIFKISSFSQELDLSHNYLYGGIPEEVGNLINLKKLSISDNRLSGNIPSTLGQCVVLESLEMQSNLFAGSIPN

SFENLVGIQKLDISRNNMSGKIPDFLGNFSLLYDLNLSFNNFDGEVPANGIFRNASVVSMEGNNGLCARTLIEGI

PLCSTQVHRKRRHKSLVLVLVIVIPIISIAIICLSFAVFLWRKRIQVKPNLPQCNEHKLKNITYEDIAKATNMFS

PDNLIGSGSFAMVYKGNLELQEDEVAIKIFNLGTYGAHKSFIAECETLRNVRHRNLVKIVTLCSSVDATGADFKA

LVFQYMRNGNLDTWLHPKAHELSQRKALNICQRVNIALDVAFALDYLHNQCATPLIHCDLKPSNILLDLDMVAYV

SDFGLARFICNRLTANQDTSTSLPCLKGSIGYIPPEYGMSKDISTKGDVYSFGILLLEIITGRSPTDEIFNGSTT

LHEFVDRAFPNNISKTKSDFIVLEEVQENG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	101	124	0.27
LRR [Pfam ls]	125	148	1.1
LRR [Pfam ls]	149	172	0.0098
LRR [Pfam ls]	173	196	0.0058
LRR [Pfam ls]	221	244	0.81
LRR [Pfam ls]	245	269	0.91
LRR [Pfam ls]	293	316	0.077
LRR [Pfam ls]	365	389	5.6
LRR [Pfam ls]	390	413	1.3
LRR [Pfam ls]	414	436	0.25
LRR [Pfam ls]	437	460	0.97
LRR [Pfam ls]	464	487	0.3
LRR [Pfam ls]	489	512	0.043
LRR [Pfam ls]	513	536	0.11
LRR [Pfam ls]	537	560	6.6
LRR [Pfam ls]	561	584	0.94
LRR [Pfam ls]	585	609	0.9
LRR [Pfam ls]	634	657	0.22
LRR [Pfam ls]	658	681	5.9
LRR [Pfam ls]	682	705	0.42
Ser/Thr pkinase [Pfam fs]	824	1071	5.9e-43
Ser/Thr pkinase [Pfam ls]	824	1076	6.6e-35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	101	124	0.012
LRR [sensitive, ls]	101	124	0.27
LRR [sensitive, ls]	125	148	0.048
LRR [sensitive, ls]	125	148	1.1
LRR [sensitive, ls]	149	172	0.00042
LRR [sensitive, ls]	149	172	0.0098
LRR [sensitive, ls]	173	196	0.00025
LRR [sensitive, ls]	173	196	0.0058
LRR [sensitive, ls]	197	217	0.78
LRR [sensitive, ls]	197	217	18
LRR [sensitive, ls]	221	244	0.035
LRR [sensitive, ls]	221	244	0.81
LRR [sensitive, ls]	245	269	0.039
LRR [sensitive, ls]	245	269	0.91
LRR [sensitive, ls]	293	316	0.0033
LRR [sensitive, ls]	293	316	0.077
LRR [sensitive, ls]	317	340	0.5
LRR [sensitive, ls]	317	340	12
LRR [sensitive, ls]	341	364	0.34
LRR [sensitive, ls]	341	364	7.9
LRR [sensitive, ls]	365	389	0.24
LRR [sensitive, ls]	365	389	5.6
LRR [sensitive, ls]	390	413	0.055
LRR [sensitive, ls]	390	413	1.3
LRR [sensitive, ls]	414	436	0.011
LRR [sensitive, ls]	414	436	0.25
LRR [sensitive, ls]	437	460	0.042
LRR [sensitive, ls]	437	460	0.97
LRR [sensitive, ls]	464	487	0.013
LRR [sensitive, ls]	464	487	0.3
LRR [sensitive, ls]	489	512	0.0018
LRR [sensitive, ls]	489	512	0.043
LRR [sensitive, ls]	513	536	0.0046
LRR [sensitive, ls]	513	536	0.11
LRR [sensitive, ls]	537	560	0.28
LRR [sensitive, ls]	537	560	6.6
LRR [sensitive, ls]	561	584	0.04
LRR [sensitive, ls]	561	584	0.94
LRR [sensitive, ls]	585	609	0.039
LRR [sensitive, ls]	585	609	0.9
LRR [sensitive, ls]	610	633	0.6
LRR [sensitive, ls]	610	633	14
LRR [sensitive, ls]	634	657	0.0094
LRR [sensitive, ls]	634	657	0.22
LRR [sensitive, ls]	658	681	0.25
LRR [sensitive, ls]	658	681	5.9
LRR [sensitive, ls]	682	705	0.018
LRR [sensitive, ls]	682	705	0.42
LRR [sensitive, ls]	706	731	1.4
LRR [sensitive, ls]	706	731	32

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	6	1061	1e-166
Cf-9 [L. pimpinellifolium]	11	741	1e-74
Xa21 [O. sativa]	11	627	4e-85
CLV2 [A. thaliana]	16	745	2e-66
Xa21 [O. sativa]	77	270	5e-18
Xa21 [O. sativa]	203	935	1e-164
Xa21 [O. sativa]	581	739	3e-15
Rpg1 [Hordeum vulgare]	807	1056	2e-27
Pto [L. esculentum]	815	1039	1e-24
Rpg1 [Hordeum vulgare]	821	1069	5e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	5	27	in -> out
putative TM domain	769	791	out -> in
putative TM domain	769	791	out -> in

Report for 1950.m00140

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)