Report for 1950.m00143

 > 1950.m00143, length: 930, copies: 3 

MSASSLWSRYSRSHITDNVNLGNNALTGGVPKPMLNSSSLQQLILNSNSLSGELPKALLNTLSLISIYLNQNNFS

GSIPPVKTVSPQVQYLDLGENCLTGTIPSSVGNLSSLLYLRLSQNCLDGSIPESLGHIPTLEELNLNLNNFSGAV

PPSLFNMSSLTSLVAANNSLTGRLPLDIGYTLPNIEGLILSANKFKGSIPTSLLNLTHLQMLYLADNKLTGIMPS

FGSLTNLEDLDVAYNMLEAGDWGFISSLSNCTRLTKLMLDGNNLQGNLPSSVGNLSSDLQRLWLTNNKISGPIPQ

EIGNLKSLTELYMDYNQLSEKIPLTIGNLRKLGKLSFARNRLSGQIPDDIGKLVQLNNLNLDWNNLSGSIPVSIG

YCTQLEILNLAHNSLDGTIPETIFKISSLSIVLDLSYNYLSGSISDEVGNLVSLNKLIISYNRLSGDIPSTLSQC

VVLEYLEMQSNFFVGSIPQTFVNMVGIKVMDISHNNLSGEIPQFLTLLHSLQVLNLSFNNFDGAVPTSGIFANAS

VVSIEGNDYLCTKTPMRGVPLCSKSVDKKRNHRSLVLVLTTVIPIVAITFTLLCLAKYIWTKRMQAEPHVQQLNE

HRNITYEDVLKATNRFSSTNLLGSGSFGTVYKGNLHLPFKEKDNLHLQEEHIAIKIFNLDIHGSNKSFVAECETL

QNVRHRNLVKIITLCSSVDSTGADFKAIVFPYFPNGNLDMWLHPKSHEHISQTKVLTLRQRINIALDVALALDYL

HNQCELPLVHCDLKPSNILLDSDMVAHVSDFGLARFVYTRSNAHQYTSTSLACLKGSIGYIPPEYGMSKDISTKG

DVYSFGILLLEMVTGSSPIDEKFNGGTTLHEFVDAALSNSIHEVVDPTMLQDDVSVADVMERCVIPLVKIGLSCS

MALPRERPEMGQVSNMILRIKHAASNMSVK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	63	85	6.5
LRR [Pfam ls]	87	110	0.07
LRR [Pfam ls]	111	134	1.4
LRR [Pfam ls]	135	158	2.9
LRR [Pfam ls]	159	183	7.3
LRR [Pfam ls]	184	207	5
LRR [Pfam ls]	208	230	0.0072
LRR [Pfam ls]	231	257	6.4
LRR [Pfam ls]	258	281	0.19
LRR [Pfam ls]	283	306	0.18
LRR [Pfam ls]	307	330	0.43
LRR [Pfam ls]	355	378	3.9
LRR [Pfam ls]	379	403	0.39
LRR [Pfam ls]	428	451	2
LRR [Pfam ls]	476	498	2.2
LRR [Pfam ls]	500	525	3.5
Ser/Thr pkinase [Pfam fs]	616	843	3.8e-46
Ser/Thr pkinase [Pfam ls]	616	903	1.4e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	39	62	0.54
LRR [sensitive, ls]	39	62	12
LRR [sensitive, ls]	63	85	0.28
LRR [sensitive, ls]	63	85	6.5
LRR [sensitive, ls]	87	110	0.003
LRR [sensitive, ls]	87	110	0.07
LRR [sensitive, ls]	111	134	0.06
LRR [sensitive, ls]	111	134	1.4
LRR [sensitive, ls]	135	158	0.13
LRR [sensitive, ls]	135	158	2.9
LRR [sensitive, ls]	159	183	0.32
LRR [sensitive, ls]	159	183	7.3
LRR [sensitive, ls]	184	207	0.21
LRR [sensitive, ls]	184	207	5
LRR [sensitive, ls]	208	230	0.00031
LRR [sensitive, ls]	208	230	0.0072
LRR [sensitive, ls]	231	257	0.28
LRR [sensitive, ls]	231	257	6.4
LRR [sensitive, ls]	258	281	0.0081
LRR [sensitive, ls]	258	281	0.19
LRR [sensitive, ls]	283	306	0.0077
LRR [sensitive, ls]	283	306	0.18
LRR [sensitive, ls]	307	330	0.019
LRR [sensitive, ls]	307	330	0.43
LRR [sensitive, ls]	331	354	0.37
LRR [sensitive, ls]	331	354	8.6
LRR [sensitive, ls]	355	378	0.17
LRR [sensitive, ls]	355	378	3.9
LRR [sensitive, ls]	379	403	0.017
LRR [sensitive, ls]	379	403	0.39
LRR [sensitive, ls]	404	427	1.9
LRR [sensitive, ls]	404	427	45
LRR [sensitive, ls]	428	451	0.085
LRR [sensitive, ls]	428	451	2
LRR [sensitive, ls]	452	475	0.77
LRR [sensitive, ls]	452	475	18
LRR [sensitive, ls]	476	498	0.094
LRR [sensitive, ls]	476	498	2.2
LRR [sensitive, ls]	500	525	0.15
LRR [sensitive, ls]	500	525	3.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	2	546	6e-57
Xa21 [O. sativa]	3	395	7e-54
Xa21 [O. sativa]	5	202	4e-23
Xa21 [O. sativa]	10	175	6e-11
FLS2 [A.thaliana]	11	534	5e-72
FLS2 [A.thaliana]	13	926	1e-134
Xa21 [O. sativa]	14	738	1e-152
CLV2 [A. thaliana]	18	396	2e-35
Cf-9 [L. pimpinellifolium]	19	516	2e-48
CLV2 [A. thaliana]	19	540	3e-56
FLS2 [A.thaliana]	24	518	9e-72
CLV2 [A. thaliana]	43	516	2e-52
CLV2 [A. thaliana]	98	520	2e-47
Cf-9 [L. pimpinellifolium]	129	532	9e-36
Xa21 [O. sativa]	132	516	1e-55
Cf-9 [L. pimpinellifolium]	235	518	1e-15
Rpg1 [Hordeum vulgare]	598	920	1e-26
Pto [L. esculentum]	607	913	1e-27
Rpg1 [Hordeum vulgare]	613	840	2e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	559	581	out -> in
putative TM domain	559	581	out -> in

Report for 1950.m00143

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)