Report for 1950.m00149

 > 1950.m00149, length: 837, copies: 2 

MAPLGSHSIPVLVTILLACFSFFLITAFSLVPTAPLHDASDTTDFQALLCLKLHLNDNAGVMASWRNDSSQYCQW

PGVTCSKSHTSRVTELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQLTGNIPPEIGHLRRLTYLNLTSNGLTGTI

PEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQAICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNIPFS

LGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFALFNSSSLNLISLAVNNFVGSIPPISNI

SSPLWYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTVPASLYNMSN

LVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQIPTSLGIAKNLQVINLRDNAFHGIIPSFGNLPDLME

LNLGMNRLEAGDWSFLSSLITSRQLVQLCLDKNILKGTLPSSIAKLSTSLQVLLLTGNEISGTIPQEIEKLTSLT

LLYMEKNLLTGNLPDSLGNLLNLFILSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGSCKNLEALN

LSCNSFDSSIPEELVTLSSLSEWLDLSHNQLDGEIPSEIGGSINLDILNISNNRLSGQIPSALGDCVHLSSLRME

GNLLDGRIPDSFINLRGIVELDLSQNNLSGKIPEFMESFGSMKLLNLSFNDFEGQVPTEGIFQNASEVFIQGNKK

LCGTYPLLQLPLCNVKPSKGKHTNKILKIVGPIAICLALTSCLALILLKKRNKVKQASDPSCKELKTFTYSTLKK

IPRIIVTLKIMS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	87	110	2.1
LRR [Pfam ls]	111	134	1.2
LRR [Pfam ls]	135	158	0.011
LRR [Pfam ls]	159	182	0.57
LRR [Pfam ls]	183	206	1.8
LRR [Pfam ls]	207	230	0.15
LRR [Pfam ls]	231	254	3.8
LRR [Pfam ls]	255	278	1.3
LRR [Pfam ls]	303	326	1.3
LRR [Pfam ls]	327	350	0.038
LRR [Pfam ls]	351	374	0.0063
LRR [Pfam ls]	424	446	0.0061
LRR [Pfam ls]	499	522	0.018
LRR [Pfam ls]	523	546	3.5
LRR [Pfam ls]	547	570	0.13
LRR [Pfam ls]	571	594	0.057
LRR [Pfam ls]	595	618	0.68
LRR [Pfam ls]	644	667	0.063
LRR [Pfam ls]	668	691	4.2
LRR [Pfam ls]	692	714	1.6

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	87	110	0.09
LRR [sensitive, ls]	87	110	2.1
LRR [sensitive, ls]	111	134	0.051
LRR [sensitive, ls]	111	134	1.2
LRR [sensitive, ls]	135	158	0.00046
LRR [sensitive, ls]	135	158	0.011
LRR [sensitive, ls]	159	182	0.025
LRR [sensitive, ls]	159	182	0.57
LRR [sensitive, ls]	183	206	0.077
LRR [sensitive, ls]	183	206	1.8
LRR [sensitive, ls]	207	230	0.0066
LRR [sensitive, ls]	207	230	0.15
LRR [sensitive, ls]	231	254	0.16
LRR [sensitive, ls]	231	254	3.8
LRR [sensitive, ls]	255	278	0.057
LRR [sensitive, ls]	255	278	1.3
LRR [sensitive, ls]	279	301	0.93
LRR [sensitive, ls]	279	301	22
LRR [sensitive, ls]	303	326	0.057
LRR [sensitive, ls]	303	326	1.3
LRR [sensitive, ls]	327	350	0.0017
LRR [sensitive, ls]	327	350	0.038
LRR [sensitive, ls]	351	374	0.00027
LRR [sensitive, ls]	351	374	0.0063
LRR [sensitive, ls]	375	399	0.9
LRR [sensitive, ls]	375	399	21
LRR [sensitive, ls]	400	420	0.38
LRR [sensitive, ls]	400	420	8.9
LRR [sensitive, ls]	424	446	0.00026
LRR [sensitive, ls]	424	446	0.0061
LRR [sensitive, ls]	474	497	0.38
LRR [sensitive, ls]	474	497	8.9
LRR [sensitive, ls]	499	522	0.00077
LRR [sensitive, ls]	499	522	0.018
LRR [sensitive, ls]	523	546	0.15
LRR [sensitive, ls]	523	546	3.5
LRR [sensitive, ls]	547	570	0.0055
LRR [sensitive, ls]	547	570	0.13
LRR [sensitive, ls]	571	594	0.0024
LRR [sensitive, ls]	571	594	0.057
LRR [sensitive, ls]	595	618	0.029
LRR [sensitive, ls]	595	618	0.68
LRR [sensitive, ls]	620	643	1.5
LRR [sensitive, ls]	620	643	34
LRR [sensitive, ls]	644	667	0.0027
LRR [sensitive, ls]	644	667	0.063
LRR [sensitive, ls]	668	691	0.18
LRR [sensitive, ls]	668	691	4.2
LRR [sensitive, ls]	692	714	0.067
LRR [sensitive, ls]	692	714	1.6
LRR [sensitive, ls]	716	741	0.91
LRR [sensitive, ls]	716	741	21

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	8	636	1e-84
CLV2 [A. thaliana]	22	664	3e-63
FLS2 [A.thaliana]	56	815	1e-110
Cf-9 [L. pimpinellifolium]	64	760	5e-77
Xa21 [O. sativa]	86	256	6e-18
Xa21 [O. sativa]	211	825	1e-113
CLV2 [A. thaliana]	253	732	3e-57

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	9	31	in -> out
putative TM domain	9	31	in -> out
putative TM domain	779	798	out -> in
putative TM domain	779	798	out -> in

Report for 1950.m00149

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)