Report for 1954.m00189

 > 1954.m00189, length: 1139, copies: 2 

MIPIGTLTPSLLTFAVLYAFLTLPLIPSLSSTALDDESNKDLQALLCLKSRLSNNARSLASWNESLQFCTWPGIT

CGKRHESRVTALHLESLDLNGHLPPCIGNLTFLTRIHLSNNRLNGEIPIEVGHLRRLVYINLSSNNLTGVIPNSL

SSCSSLEILNLGNNFLQGEIPLGLSNCSNLKRIVLHENMLHGGIPDGFTALDKLSVLFAHSNNLSGNIPHSLGSV

SSLTYVVLANNSLTGGIPPVLANCSSLQWLDLRKNHIGGEIPPALFNSSSLQAINLAENNFFGSIPPLSDLSSIQ

FLYLSYNNLSGSIPSSLGNSTSLYSLLLAWNELQGSIPSSLSRIPYLEELEFTGNNLTGTVPLPLYNMSTLTFLG

MAENNLIGELPQNIGYTLKSIEMFILQGNKFHGQIPKSLAKATNLQLINLRENAFKGIIPYFGSLPNLTILDLGK

NQLEAGDWTFLPALAHTQLAELYLDANNLQGSLPSSTGDLPQSMKILVLTSNFISGTIPQEIEQLRNLVLLQIDH

NLLTGNLPDSLGNLSNLLILSLAQNSFYGKIPLSIGKLNQLTELYLQDNSFSGLIPKALGQCQKLDILNLSCNSL

EGTIPKELFTISTLSEGLDLSHNRLSGPIPVEVGSLINLGPLNISNNKLSGEIPSALGDCVRLEYLNMEGNVLNG

QIPKSFSALRGIIQMDLSRNNLSGQIPEFFETLSSMVLLNLSFNNLEGPIPSNGIFQNASKVFLQGNKELCAISP

LLKLPLCQISASKNNHTSYIAKVVGLSVFCLVFLSCLAVFFLKRKKAKNPTDPSYKKLEKLTYADLVKVTNNFSP

TNLIGSGKYGSVYVGKFDAEAHAVAIKVFKLDQLGAPKSFIAECEALRNTRHRNLVRVITACSTFDPTGHEFKAL

VLEYMVNGNLECWLHPTSYKNRPRNPVRLSTRIEIALDMAAALDYLHNRCMPPIVHCDLKPSNVLLDNAMGARVS

DFGLAKFLHSNISSTSDRSTSLLGPRGSIGYIAPEYGFGSKISTEGDVYSYGVIILEMLTGKRPTDEMFNDGLNL

HQFAKEAFPLKIGQILDPSIMPDYENEDNDANNDLDHDNCLMDGMLNCVTKLVKLGLLCSAVAPKDRPTMQSVYK

EVAAIKEEFSALHG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	107	130	0.48
LRR [Pfam ls]	131	154	0.0069
LRR [Pfam ls]	155	178	0.074
LRR [Pfam ls]	179	202	5.3
LRR [Pfam ls]	227	250	0.13
LRR [Pfam ls]	251	274	0.11
LRR [Pfam ls]	275	297	0.87
LRR [Pfam ls]	298	321	0.011
LRR [Pfam ls]	346	369	5.5
LRR [Pfam ls]	419	441	0.069
LRR [Pfam ls]	468	491	0.67
LRR [Pfam ls]	493	516	7.2
LRR [Pfam ls]	517	540	0.42
LRR [Pfam ls]	565	588	0.015
LRR [Pfam ls]	589	613	0.092
LRR [Pfam ls]	662	685	0.22
LRR [Pfam ls]	686	709	4.1
Ser/Thr pkinase [Pfam fs]	823	1069	1.5e-46
Ser/Thr pkinase [Pfam ls]	823	1123	4.2e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	83	106	1.3
LRR [sensitive, ls]	83	106	30
LRR [sensitive, ls]	107	130	0.021
LRR [sensitive, ls]	107	130	0.48
LRR [sensitive, ls]	131	154	0.0003
LRR [sensitive, ls]	131	154	0.0069
LRR [sensitive, ls]	155	178	0.0032
LRR [sensitive, ls]	155	178	0.074
LRR [sensitive, ls]	179	202	0.23
LRR [sensitive, ls]	179	202	5.3
LRR [sensitive, ls]	203	226	0.49
LRR [sensitive, ls]	203	226	11
LRR [sensitive, ls]	227	250	0.0056
LRR [sensitive, ls]	227	250	0.13
LRR [sensitive, ls]	251	274	0.0047
LRR [sensitive, ls]	251	274	0.11
LRR [sensitive, ls]	275	297	0.037
LRR [sensitive, ls]	275	297	0.87
LRR [sensitive, ls]	298	321	0.00049
LRR [sensitive, ls]	298	321	0.011
LRR [sensitive, ls]	322	345	0.41
LRR [sensitive, ls]	322	345	9.6
LRR [sensitive, ls]	346	369	0.24
LRR [sensitive, ls]	346	369	5.5
LRR [sensitive, ls]	370	394	1.1
LRR [sensitive, ls]	370	394	27
LRR [sensitive, ls]	395	418	1.6
LRR [sensitive, ls]	395	418	37
LRR [sensitive, ls]	419	441	0.003
LRR [sensitive, ls]	419	441	0.069
LRR [sensitive, ls]	442	462	1
LRR [sensitive, ls]	442	462	23
LRR [sensitive, ls]	468	491	0.029
LRR [sensitive, ls]	468	491	0.67
LRR [sensitive, ls]	493	516	0.31
LRR [sensitive, ls]	493	516	7.2
LRR [sensitive, ls]	517	540	0.018
LRR [sensitive, ls]	517	540	0.42
LRR [sensitive, ls]	541	564	0.87
LRR [sensitive, ls]	541	564	20
LRR [sensitive, ls]	565	588	0.00065
LRR [sensitive, ls]	565	588	0.015
LRR [sensitive, ls]	589	613	0.0039
LRR [sensitive, ls]	589	613	0.092
LRR [sensitive, ls]	614	637	4.1
LRR [sensitive, ls]	614	637	95
LRR [sensitive, ls]	638	661	0.69
LRR [sensitive, ls]	638	661	16
LRR [sensitive, ls]	662	685	0.0095
LRR [sensitive, ls]	662	685	0.22
LRR [sensitive, ls]	686	709	0.18
LRR [sensitive, ls]	686	709	4.1
LRR [sensitive, ls]	710	735	0.45
LRR [sensitive, ls]	710	735	10

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	11	582	4e-86
Cf-9 [L. pimpinellifolium]	12	754	4e-70
CLV2 [A. thaliana]	18	781	3e-65
FLS2 [A.thaliana]	20	1131	1e-151
Xa21 [O. sativa]	82	262	2e-15
Xa21 [O. sativa]	233	933	1e-152
Xa21 [O. sativa]	491	716	1e-23
Xa21 [O. sativa]	618	728	2e-11
Pto [L. esculentum]	793	1123	1e-24
Rpg1 [Hordeum vulgare]	800	1037	6e-16
Rpg1 [Hordeum vulgare]	807	1037	8e-24

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	7	29	in -> out
putative TM domain	773	792	out -> in
putative TM domain	773	792	out -> in

Report for 1954.m00189

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)