Report for 1956.m00181

 > 1956.m00181, length: 1061, copies: 1 

MAMPVGVAPVLLLLLLPLAAATAAAESDDRDALMAFKAGVTSDPTGVLRSWNETVHFCRWPGVNCTAGRVTSLDV

SMGRLAGELSPAVANLTRLVVLNLTSNAFSGSIPGGLGRLRRMRYLSLCDNAFAGEIPDALRNCTALAVAYLNNN

NLVGGVPRWLGALPNLAVLRLSHNSLSGRIPPSLANLTKIFRLELDQNLLEGSIPDGLSRLPALGMLALSQNSLA

GEIPVGFFNMTSLRGLALADNAFRGELPGDAGARTPNLQYLFLGGNLLAGPISASLSNATALVALSLANNSFAGQ

VPGEIGTLCPLSLELSNNQLTATDDAGGGWEFMDNLTNCSALAEILLDGNKFAGVMPPSVVRLSPQLEALNLAGN

RISGVIPPEIESLVGLQTLCLQSNLFSGEIPEAIGKLKNLRELLLEQNELAGPVPSAIGDLTQLLKLDLSGNSLN

GSIPPSLGNLHQLTLLNLSGNELTGHVPSELFTLSSLSLLMDLSDNQLDGPIPPDVGQLTKLAFMALSGNRFSGE

VPTELESCQSLEFLDLARNVFVGSIPPSLSGLKGLRRLNLTGNRLSGSIPPELGGMPGLQELYLSRNDLSGGIPA

SLETMSSLMELDVSYNRLAGQVPVHGVFANTTGLRIAGNTALCGGAARLRLPPCPAPGNSTRRAHLFLKIALPVV

AAALCFAVMFALLRWRRKIRSSRTGNAAARSVLNGNYYPRVTYAELAKATDDFADANLVGAGKYGSVYRGTLSLK

TKGEFAREDAVVAVKVLDLRQVGASKTFMAECEALRSVKHRNLINIVTCCSSIDMEGNEFRALVFDFMPNYSLDR

WLHRAKHTETGKWCGGAGGLGVIQRLDVAVDIADALNYLHNSCNPPIIHCDLKPSNVLLGEDMTACIGDFGLAKL

LLDPASHGAAAANTESTIGIRGTIGYVAPEYGTTGMVTASGDVYSFGITLLEIFSGKAPTDGELRDGLTLPEFVA

GAFPDNIEEILDVALLLQAEELDGAASSTTSEEESEARVTVRDCLASAIRVGLSCSRRAPYERMAMSVAADEMRL

IRDACLRACGK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	116	0.34
LRR [Pfam ls]	117	140	3.3
LRR [Pfam ls]	165	188	0.0013
LRR [Pfam ls]	189	212	3.1
LRR [Pfam ls]	262	285	0.49
LRR [Pfam ls]	366	389	0.072
LRR [Pfam ls]	390	413	0.84
LRR [Pfam ls]	414	437	0.26
LRR [Pfam ls]	438	461	0.013
LRR [Pfam ls]	462	486	0.0078
LRR [Pfam ls]	535	558	0.035
LRR [Pfam fs]	559	582	4.6e-05
LRR [Pfam ls]	559	582	0.00078
LRR [Pfam ls]	583	606	0.03
Ser/Thr pkinase [Pfam fs]	728	966	3.3e-43
Ser/Thr pkinase [Pfam ls]	728	1049	1.1e-35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	116	0.015
LRR [sensitive, ls]	93	116	0.34
LRR [sensitive, ls]	117	140	0.14
LRR [sensitive, ls]	117	140	3.3
LRR [sensitive, ls]	141	164	1.6
LRR [sensitive, ls]	141	164	36
LRR [sensitive, ls]	165	188	5.7e-05
LRR [sensitive, ls]	165	188	0.0013
LRR [sensitive, ls]	189	212	0.13
LRR [sensitive, ls]	189	212	3.1
LRR [sensitive, ls]	213	236	1.2
LRR [sensitive, ls]	213	236	28
LRR [sensitive, ls]	237	261	0.87
LRR [sensitive, ls]	237	261	20
LRR [sensitive, ls]	262	285	0.021
LRR [sensitive, ls]	262	285	0.49
LRR [sensitive, ls]	286	309	2.5
LRR [sensitive, ls]	286	309	58
LRR [sensitive, ls]	341	365	2.7
LRR [sensitive, ls]	341	365	62
LRR [sensitive, ls]	366	389	0.0031
LRR [sensitive, ls]	366	389	0.072
LRR [sensitive, ls]	390	413	0.036
LRR [sensitive, ls]	390	413	0.84
LRR [sensitive, ls]	414	437	0.011
LRR [sensitive, ls]	414	437	0.26
LRR [sensitive, ls]	438	461	0.00057
LRR [sensitive, ls]	438	461	0.013
LRR [sensitive, ls]	462	486	0.00033
LRR [sensitive, ls]	462	486	0.0078
LRR [sensitive, ls]	511	534	1.9
LRR [sensitive, ls]	511	534	43
LRR [sensitive, ls]	535	558	0.0015
LRR [sensitive, ls]	535	558	0.035
LRR [sensitive, ls]	559	582	3.4e-05
LRR [sensitive, ls]	559	582	0.00078
LRR [sensitive, ls]	583	606	0.0013
LRR [sensitive, ls]	583	606	0.03
LRR [sensitive, ls]	607	631	1.9
LRR [sensitive, ls]	607	631	45

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	828	1e-150
CLV2 [A. thaliana]	16	622	6e-57
FLS2 [A.thaliana]	31	623	2e-89
Cf-9 [L. pimpinellifolium]	50	614	6e-51
FLS2 [A.thaliana]	64	576	2e-67
CLV2 [A. thaliana]	69	475	4e-31
CLV2 [A. thaliana]	73	410	2e-27
FLS2 [A.thaliana]	80	1052	1e-135
Cf-9 [L. pimpinellifolium]	92	652	2e-48
CLV2 [A. thaliana]	169	623	1e-46
CLV2 [A. thaliana]	266	624	2e-38
FLS2 [A.thaliana]	273	639	1e-47
CLV2 [A. thaliana]	511	623	5e-11
Rpg1 [Hordeum vulgare]	712	957	2e-19
Pto [L. esculentum]	715	987	2e-22
Rpg1 [Hordeum vulgare]	721	957	7e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	5	27	in -> out
putative TM domain	666	688	out -> in
putative TM domain	666	688	out -> in

Report for 1956.m00181

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)