Report for 1969.m00170

 > 1969.m00170, length: 966, copies: 2 

MLQPEEKRVDPQNQVADPAGEKDAPARREEGRSPKSSDHEKQNTQQKTSTGRRDEGGHSPETKTEGEIPSELGSL

QCLELLNLYNNNLTGSIPSYIGNLKNLILIDISDNGLTGSIPPEIGNLQNLQFMDFGKNKLSGSIPASLGNLFSL

NWLDLGNNSLVGTIPPSLGGLPYLSTFILARNKLVGNIPPSLGNLSSLTELNFARNYLTGIIPHSLGNIYGLHSL

RLTENMLTGTIPSSLGKLINLVYIGLQFNNLIGEIPLLLFNLSSLQKLDLQNNKLSGSLQNYFGDKFPLLQGLAL

NDNKFHGPIPLSLSNCSMLELIQLDKHLAILNNEVGGNIPEGIGRLSNLMALYMGPNLLTGSIPASLGKLSKLNV

ISLAQNRLSGEIPPTLGNLTQLSELYLSMNAFTGEIPSALGKCPLGVLALAYNKLSGNIPKEIFSSSRLRSISLL

SNMLVGPMPSELGLLKNLQGLDFSQNKLTGEIPISIGGCQSLEFLLVSQNFLHGSIPSTMNKLTGLQELDLSSNN

ISGIIPVFLGSFIGLTYLNLSFNNLIGEVPDDGIFRNATAFSIVGNVGLCGGIPVLSLPSCTNQQAREHKFPKLA

VAMSVSITCLFLVIGIGLISVLCKKHKSSSGPTSTRAVRNQLPRVSYTELSMGTNGFSSSNLIGEGRFGSVYKAN

MSFDQYSVVAVKVLKLQERGASHSFLAECEALRYLRHRNLVKILTACSSIDPRGHDFKALIFEYLPNGSLEKWLH

THIDEQSDQSVLNIYQKLSIATDVGSAVEYLHDYKPVPIVHCDLKPSNILLDSDMMAHVGDFGLARFTNQGDNNA

SQVSSSWAAFRGTIGYAAPEYGIGNEVTTSGDVYSYGIILLEMFTGRRPTEQNFEENTNLHRFVEEALPDSVEDV

VDQNLILPREDTEMDHNTLLNKEAALACITSILRVGILCSKQLPTERVQIRDAVIELHKIKEKFFP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	77	100	0.0013
LRR [Pfam ls]	101	124	0.0084
LRR [Pfam ls]	125	148	3.1
LRR [Pfam ls]	149	172	0.005
LRR [Pfam ls]	197	220	0.45
LRR [Pfam ls]	221	244	1
LRR [Pfam ls]	245	268	6.6
LRR [Pfam ls]	269	293	0.095
LRR [Pfam ls]	372	395	0.13
LRR [Pfam ls]	396	419	4.1
LRR [Pfam ls]	467	490	0.29
LRR [Pfam ls]	515	538	0.012
LRR [Pfam ls]	539	564	1
Ser/Thr pkinase [Pfam fs]	657	891	9.5e-47
Ser/Thr pkinase [Pfam ls]	657	920	7.7e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	77	100	5.6e-05
LRR [sensitive, ls]	77	100	0.0013
LRR [sensitive, ls]	101	124	0.00036
LRR [sensitive, ls]	101	124	0.0084
LRR [sensitive, ls]	125	148	0.13
LRR [sensitive, ls]	125	148	3.1
LRR [sensitive, ls]	149	172	0.00022
LRR [sensitive, ls]	149	172	0.005
LRR [sensitive, ls]	173	196	0.63
LRR [sensitive, ls]	173	196	15
LRR [sensitive, ls]	197	220	0.019
LRR [sensitive, ls]	197	220	0.45
LRR [sensitive, ls]	221	244	0.045
LRR [sensitive, ls]	221	244	1
LRR [sensitive, ls]	245	268	0.28
LRR [sensitive, ls]	245	268	6.6
LRR [sensitive, ls]	269	293	0.0041
LRR [sensitive, ls]	269	293	0.095
LRR [sensitive, ls]	294	317	1.2
LRR [sensitive, ls]	294	317	27
LRR [sensitive, ls]	348	371	2.8
LRR [sensitive, ls]	348	371	64
LRR [sensitive, ls]	372	395	0.0057
LRR [sensitive, ls]	372	395	0.13
LRR [sensitive, ls]	396	419	0.18
LRR [sensitive, ls]	396	419	4.1
LRR [sensitive, ls]	443	466	2.7
LRR [sensitive, ls]	443	466	63
LRR [sensitive, ls]	467	490	0.012
LRR [sensitive, ls]	467	490	0.29
LRR [sensitive, ls]	491	514	0.41
LRR [sensitive, ls]	491	514	9.6
LRR [sensitive, ls]	515	538	0.00051
LRR [sensitive, ls]	515	538	0.012
LRR [sensitive, ls]	539	564	0.045
LRR [sensitive, ls]	539	564	1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	61	412	2e-33
CLV2 [A. thaliana]	61	424	4e-37
FLS2 [A.thaliana]	61	963	1e-135
FLS2 [A.thaliana]	61	555	1e-82
Xa21 [O. sativa]	61	341	2e-37
Cf-9 [L. pimpinellifolium]	66	459	2e-39
CLV2 [A. thaliana]	66	629	3e-55
FLS2 [A.thaliana]	66	588	4e-85
CLV2 [A. thaliana]	67	583	7e-55
Cf-9 [L. pimpinellifolium]	68	622	2e-55
Cf-9 [L. pimpinellifolium]	70	556	1e-45
Xa21 [O. sativa]	81	769	1e-138
FLS2 [A.thaliana]	101	579	5e-65
CLV2 [A. thaliana]	102	554	9e-48
CLV2 [A. thaliana]	136	566	1e-50
Cf-9 [L. pimpinellifolium]	153	556	2e-30
Xa21 [O. sativa]	198	555	1e-49
Cf-9 [L. pimpinellifolium]	304	582	1e-16
CLV2 [A. thaliana]	359	579	2e-17
CLV2 [A. thaliana]	372	555	7e-18
FLS2 [A.thaliana]	440	580	3e-13
CLV2 [A. thaliana]	441	589	9e-11
Xa21 [O. sativa]	443	579	1e-14
Rpg1 [Hordeum vulgare]	643	872	8e-21
Pto [L. esculentum]	644	905	1e-22
Rpg1 [Hordeum vulgare]	654	872	2e-23

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	529	551	out -> in
putative TM domain	529	551	out -> in
putative TM domain	558	580	in -> out
putative TM domain	558	580	in -> out
putative TM domain	600	622	out -> in
putative TM domain	600	622	out -> in

Report for 1969.m00170

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)