Report for 1977.m00154

 > 1977.m00154, length: 994, copies: 2 

MPPTLLLLLLLLPPSLASPDRDIYALAKLKAALVPSPSATAPPPLADWDPAATSPAHCTFSGVTCDGRSRVVAIN

LTALPLHSGYLPPEIALLDSLANLTIAACCLPGHVPLELPTLPSLRHLNLSNNNLSGHFPVPDSGGGASPYFPSL

ELIDAYNNNLSGLLPPFSASHARLRYLHLGGNYFTGAIPDSYGDLAALEYLGLNGNTLSGHVPVSLSRLTRLREM

YIGYYNQYDGGVPPEFGDLGALLRLDMSSCNLTGPVPPELGRLQRLDTLFLQWNRLSGEIPPQLGDLSSLASLDL

SVNDLAGEIPPSLANLSNLKLLNLFRNHLRGSIPDFVAGFAQLEVLQLWDNNLTGNIPAGLGKNGRLKTLDLATN

HLTGPIPADLCAGRRLEMLVLMENGLFGPIPDSLGDCKTLTRVRLAKNFLTGPVPAGLFNLPQANMVELTDNLLT

GELPDVIGGDKIGMLLLGNNGIGGRIPPAIGNLPALQTLSLESNNFSGALPPEIGNLKNLSRLNVSGNALTGAIP

DELIRCASLAAVDLSRNGFSGEIPESITSLKILCTLNVSRNRLTGELPPEMSNMTSLTTLDVSYNSLSGPVPMQG

QFLVFNESSFVGNPGLCGGPVADACPPSMAGGGGGAGSQLRLRWDSKKMLVALVAAFAAVAVAFLGARKGCSAWR

SAARRRSGAWKMTAFQKLEFSAEDVVECVKEDNIIGKGGAGIVYHGVTRGAELAIKRLVGRGGGEHDRGFSAEVT

TLGRIRHRNIVRLLGFVSNRETNLLLYEYMPNGSLGEMLHGGKGGHLGWEARARVAAEAACGLCYLHHDCAPRII

HRDVKSNNILLDSAFEAHVADFGLAKFLGGATSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITG

RRPVGGFGDGVDIVHWVRKVTAELPDNSDTAAVLAVADRRLTPEPVALMVNLYKVAMACVEEASTARPTMREVVH

MLSNPNSAQPNSGDLLVTF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	144	0.13
LRR [Pfam ls]	149	171	1.4
LRR [Pfam ls]	173	196	0.46
LRR [Pfam ls]	197	220	1.7
LRR [Pfam ls]	246	269	6.3
LRR [Pfam ls]	270	293	0.67
LRR [Pfam ls]	294	317	0.25
LRR [Pfam ls]	318	341	0.99
LRR [Pfam ls]	342	365	1.1
LRR [Pfam ls]	461	484	4.7
LRR [Pfam ls]	485	508	0.099
LRR [Pfam ls]	509	532	2.2
LRR [Pfam ls]	533	556	2.6
Ser/Thr pkinase [Pfam fs]	704	903	2e-43
Ser/Thr pkinase [Pfam ls]	704	979	1.6e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	119	144	0.0057
LRR [sensitive, ls]	119	144	0.13
LRR [sensitive, ls]	149	171	0.06
LRR [sensitive, ls]	149	171	1.4
LRR [sensitive, ls]	173	196	0.02
LRR [sensitive, ls]	173	196	0.46
LRR [sensitive, ls]	197	220	0.071
LRR [sensitive, ls]	197	220	1.7
LRR [sensitive, ls]	246	269	0.27
LRR [sensitive, ls]	246	269	6.3
LRR [sensitive, ls]	270	293	0.029
LRR [sensitive, ls]	270	293	0.67
LRR [sensitive, ls]	294	317	0.011
LRR [sensitive, ls]	294	317	0.25
LRR [sensitive, ls]	318	341	0.042
LRR [sensitive, ls]	318	341	0.99
LRR [sensitive, ls]	342	365	0.046
LRR [sensitive, ls]	342	365	1.1
LRR [sensitive, ls]	366	389	0.49
LRR [sensitive, ls]	366	389	11
LRR [sensitive, ls]	390	413	0.85
LRR [sensitive, ls]	390	413	20
LRR [sensitive, ls]	414	437	0.48
LRR [sensitive, ls]	414	437	11
LRR [sensitive, ls]	461	484	0.2
LRR [sensitive, ls]	461	484	4.7
LRR [sensitive, ls]	485	508	0.0043
LRR [sensitive, ls]	485	508	0.099
LRR [sensitive, ls]	509	532	0.093
LRR [sensitive, ls]	509	532	2.2
LRR [sensitive, ls]	533	556	0.11
LRR [sensitive, ls]	533	556	2.6
LRR [sensitive, ls]	557	580	0.39
LRR [sensitive, ls]	557	580	9
LRR [sensitive, ls]	581	602	0.48
LRR [sensitive, ls]	581	602	11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	790	2e-76
FLS2 [A.thaliana]	22	597	6e-79
CLV2 [A. thaliana]	60	628	2e-52
Cf-9 [L. pimpinellifolium]	75	625	6e-57
FLS2 [A.thaliana]	75	974	1e-113
Cf-9 [L. pimpinellifolium]	149	613	5e-45
CLV2 [A. thaliana]	159	580	1e-50
Cf-9 [L. pimpinellifolium]	201	597	3e-32
FLS2 [A.thaliana]	346	603	6e-33
CLV2 [A. thaliana]	461	653	3e-14
Pto [L. esculentum]	689	977	3e-33
Rpg1 [Hordeum vulgare]	698	979	9e-28
Rpg1 [Hordeum vulgare]	700	993	7e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 1977.m00154

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)