Report for 1978.m00150

 > 1978.m00150, length: 779, copies: 2 

MTGERGDLLARLAGGRGVLFDGVTARVVARQHLPARRERSCTEQEESSLIGFLDGLLQGGNGSLCMSWVKRTDCC

KWEGITCSSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPMELLFSRSIIVLDVSFNRLDGSL

PELQSSSGGFPLQVLNISSNLFTGQFSSKLWEAMKNIVALNASNNSFTGQIPSSICINSPSLAILDLSYNQFSGS

IPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLPSNDLQGVLDGSDILKLVKLTVLDLGSTGLSGNIP

DSIGQLSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLNLRIADFSINNFTGTVPESI

YSCSNLIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNFKGETISKSET

IDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWISDLPVLFYLDITNNSLTGDIPTALMN

TPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEI

PQQICNLTNLQLLDLSSNQLTGELPSALTDMHFLSKFNVSNNELEGPVPTGGQFDTFLNSSYSGNSKLCGAVLSN

LCSPTTRKENFTSQRRNLRCALVTGITLGALVALALLACFLIGRLEPDEELLLGFAFGPTLNNEGMGEMSNAVGL

QAQNIAFKVILSSNLLEYESHWRFESLFA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	135	157	6.3
LRR [Pfam ls]	186	210	4.2
LRR [Pfam ls]	211	234	0.0098
LRR [Pfam ls]	284	307	0.36
LRR [Pfam ls]	308	331	0.11
LRR [Pfam ls]	332	356	0.58
LRR [Pfam ls]	456	479	3.6
LRR [Pfam ls]	480	503	0.0016
LRR [Pfam ls]	504	527	6.8
LRR [Pfam ls]	609	632	0.0029

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	111	134	2.7
LRR [sensitive, ls]	111	134	62
LRR [sensitive, ls]	135	157	0.27
LRR [sensitive, ls]	135	157	6.3
LRR [sensitive, ls]	161	185	0.38
LRR [sensitive, ls]	161	185	8.8
LRR [sensitive, ls]	186	210	0.18
LRR [sensitive, ls]	186	210	4.2
LRR [sensitive, ls]	211	234	0.00042
LRR [sensitive, ls]	211	234	0.0098
LRR [sensitive, ls]	235	258	3
LRR [sensitive, ls]	235	258	70
LRR [sensitive, ls]	259	283	0.37
LRR [sensitive, ls]	259	283	8.7
LRR [sensitive, ls]	284	307	0.016
LRR [sensitive, ls]	284	307	0.36
LRR [sensitive, ls]	308	331	0.0049
LRR [sensitive, ls]	308	331	0.11
LRR [sensitive, ls]	332	356	0.025
LRR [sensitive, ls]	332	356	0.58
LRR [sensitive, ls]	380	403	1.1
LRR [sensitive, ls]	380	403	25
LRR [sensitive, ls]	404	426	3
LRR [sensitive, ls]	404	426	69
LRR [sensitive, ls]	456	479	0.16
LRR [sensitive, ls]	456	479	3.6
LRR [sensitive, ls]	480	503	6.9e-05
LRR [sensitive, ls]	480	503	0.0016
LRR [sensitive, ls]	504	527	0.29
LRR [sensitive, ls]	504	527	6.8
LRR [sensitive, ls]	561	584	0.65
LRR [sensitive, ls]	561	584	15
LRR [sensitive, ls]	585	608	0.75
LRR [sensitive, ls]	585	608	18
LRR [sensitive, ls]	609	632	0.00012
LRR [sensitive, ls]	609	632	0.0029

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	45	716	2e-60
Cf-9 [L. pimpinellifolium]	66	677	2e-63
CLV2 [A. thaliana]	72	679	6e-49
FLS2 [A.thaliana]	75	678	8e-65
FLS2 [A.thaliana]	87	298	2e-22
FLS2 [A.thaliana]	93	345	7e-27
FLS2 [A.thaliana]	98	716	1e-63
CLV2 [A. thaliana]	136	661	1e-40
FLS2 [A.thaliana]	263	683	7e-34

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	696	718	out -> in
putative TM domain	696	718	out -> in

Report for 1978.m00150

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)