Report for 1996.m00128

 > 1996.m00128, length: 994, copies: 1 

MWATLLCKHLQIKIRIGIVHQLVLLLMSSSLFLVVSAQSVPADNMDQEALLGLKSLVTSDPSGMLLSWGNGSACT

WSGVRCNRHGRVLVLDLQGLNLVGKISPSIGNLSALHGLYLQKNQFSGEIPDQIGWLGQLQTLNASANILTGNIP

AALINCTNLEIIDLSQNTFFGTIPASISSFQKLRVLKIGGNQLSGSVPRYIGNLSLLSTLDLSTNNLTGTIPYEF

GHLRQLKYLQLSINNLKGTVPEPLYNLSSLSFFAIANNDLHGKIPSDVGFRLPRLLVFHICINRFTGPIPPSLHN

VTNIQSIRMSHNHFSGSVPPGLSGLHNLVLYNIGFNQIVGNTSVLVDLMNCTKLQLIAFDENLIEGILPDSIGNL

SSSLTRLYVGGNRITGYIPASIGRLSSLTLLNMSYNLLFGSIPPEIGLLKELTMLSLARNKLSGIIPAEIGDLAQ

LTRLEMNHNELVGEIPVEIGNLQHVLSLDISSNSLKGGIPASIFSLNSLSTLLNLSHNLLTGSIRENIGQLGQIT

AIDLSYNFLNGSIPVSIGKCQSLQSLSLSRNSLSGVIPGTIGNLKGLQTLDLSSNQLSGIIPATLVKMQALRLLN

LSMNDLDGLVPNNGIFKDHSVVYLDGNPKLCYSNMLCYYIHSSHRRKMAVAIAVGTAAMAAITIVVIISMLLLPR

KWLRNRKPKKLGSFIKKSHPLVSYEELNQVTSSFDNRNLIGTGGFGSVYKAVLRSRTAVAIKVLDLHKMGALKSW

TAECEALRNVRHRYLVKLVTMCASIDFSGNEFRALVYELMSCGSVEDLIHKGRQGENVAGVNADMILSIAIDVAS

ALDYLHNDCGEQVVHCDIKPSNVLLDEDMTAKVGDFGIWVWGVNHQQRPMSTATGMLLLEMITGKRPVDPQFGGD

MNLEKWVRDGFPHRAHEVVDERLRGTIVDICHEGQQQASAEQKRQQLMLNNIILPVMEVALSCALESPDERSTMR

DALCRLKRIKEAFLKNHSF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	134	157	3.6
LRR [Pfam ls]	158	181	1
LRR [Pfam ls]	182	205	0.41
LRR [Pfam ls]	206	229	0.091
LRR [Pfam ls]	230	253	1.3
LRR [Pfam ls]	303	326	0.054
LRR [Pfam ls]	353	376	3.4
LRR [Pfam ls]	378	401	0.27
LRR [Pfam ls]	402	425	0.15
LRR [Pfam ls]	426	449	2.8
LRR [Pfam ls]	450	473	0.17
LRR [Pfam ls]	474	498	1.1
LRR [Pfam ls]	523	546	6.9
LRR [Pfam ls]	547	570	0.0016
LRR [Pfam ls]	571	594	0.015
Ser/Thr pkinase [Pfam fs]	709	864	1.8e-33
Ser/Thr pkinase [Pfam ls]	709	949	1.8e-18

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	86	109	0.48
LRR [sensitive, ls]	86	109	11
LRR [sensitive, ls]	110	133	1.7
LRR [sensitive, ls]	110	133	40
LRR [sensitive, ls]	134	157	0.15
LRR [sensitive, ls]	134	157	3.6
LRR [sensitive, ls]	158	181	0.043
LRR [sensitive, ls]	158	181	1
LRR [sensitive, ls]	182	205	0.018
LRR [sensitive, ls]	182	205	0.41
LRR [sensitive, ls]	206	229	0.0039
LRR [sensitive, ls]	206	229	0.091
LRR [sensitive, ls]	230	253	0.058
LRR [sensitive, ls]	230	253	1.3
LRR [sensitive, ls]	254	278	1.5
LRR [sensitive, ls]	254	278	34
LRR [sensitive, ls]	279	302	4.1
LRR [sensitive, ls]	279	302	94
LRR [sensitive, ls]	303	326	0.0023
LRR [sensitive, ls]	303	326	0.054
LRR [sensitive, ls]	353	376	0.14
LRR [sensitive, ls]	353	376	3.4
LRR [sensitive, ls]	378	401	0.012
LRR [sensitive, ls]	378	401	0.27
LRR [sensitive, ls]	402	425	0.0065
LRR [sensitive, ls]	402	425	0.15
LRR [sensitive, ls]	426	449	0.12
LRR [sensitive, ls]	426	449	2.8
LRR [sensitive, ls]	450	473	0.0075
LRR [sensitive, ls]	450	473	0.17
LRR [sensitive, ls]	474	498	0.046
LRR [sensitive, ls]	474	498	1.1
LRR [sensitive, ls]	499	522	1.5
LRR [sensitive, ls]	499	522	36
LRR [sensitive, ls]	523	546	0.3
LRR [sensitive, ls]	523	546	6.9
LRR [sensitive, ls]	547	570	7.1e-05
LRR [sensitive, ls]	547	570	0.0016
LRR [sensitive, ls]	571	594	0.00066
LRR [sensitive, ls]	571	594	0.015
LRR [sensitive, ls]	595	614	4.4
LRR [sensitive, ls]	595	614	100

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	21	611	6e-54
Xa21 [O. sativa]	22	800	1e-149
CLV2 [A. thaliana]	24	586	1e-64
FLS2 [A.thaliana]	25	611	2e-84
CLV2 [A. thaliana]	86	470	8e-38
FLS2 [A.thaliana]	86	435	8e-38
Cf-9 [L. pimpinellifolium]	89	247	2e-14
FLS2 [A.thaliana]	89	532	3e-49
FLS2 [A.thaliana]	90	985	1e-100
Cf-9 [L. pimpinellifolium]	109	630	9e-58
FLS2 [A.thaliana]	169	613	9e-48
CLV2 [A. thaliana]	182	625	2e-50
Pto [L. esculentum]	684	863	4e-18
Rpg1 [Hordeum vulgare]	698	863	9e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	650	672	out -> in
putative TM domain	650	672	out -> in

Report for 1996.m00128

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)