Report for 2012.m00159

 > 2012.m00159, length: 1053, copies: 1 

MRLHYHHLAVVLLAAVAAAATAAAGGEADALLAVKAALDDPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDV

SGRNLTGGLPGAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALRVLDLY

NNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFN

SYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALA

GEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENTSPAGSLDVRIPIVVDIDRDAHGRRSLWEN

NFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLN

GSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGE

IPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPA

TIAAMQSLTAVDFSYNNLSGLVPATGQFSYFNATSFVGNPGLCGPYLGPCHPGAPGTDHGGRSHGGLSNSFKLLI

VLGLLALSIAFAAMAILKARSLKKASEARAWKLTAFQRLEFTCDDVLDSLKEENIIGKGGAGTVYKGTMPDGEHV

AVKRLPAMSRGSSHDHGFSAEIQTLGRIRHRYIVRLLGFCSNNETNLLVYEYMPNGSLGELLHGKKGGHLHWDTR

YKVAVEAAKGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYA

YTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVA

LLCVEEQSVQRPTMREVVQILSELPKPTSKQGEEPPSGEGAVFDLVVPAESAEANEAKEQQQQQLNSPSSPPPDL

ISI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	94	117	3.4
LRR [Pfam ls]	119	142	0.03
LRR [Pfam ls]	143	164	0.32
LRR [Pfam ls]	167	190	1.5
LRR [Pfam ls]	191	214	0.0096
LRR [Pfam ls]	240	263	0.73
LRR [Pfam ls]	288	311	0.015
LRR [Pfam ls]	312	335	0.1
LRR [Pfam ls]	390	414	0.029
LRR [Pfam ls]	438	461	1.3
LRR [Pfam ls]	462	486	6.8
LRR [Pfam ls]	487	510	2.5
LRR [Pfam ls]	511	534	6.3
LRR [Pfam ls]	559	582	0.0018
LRR [Pfam ls]	607	629	3.7
Ser/Thr pkinase [Pfam fs]	725	927	2.2e-51
Ser/Thr pkinase [Pfam ls]	725	974	1.5e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	69	93	0.59
LRR [sensitive, ls]	69	93	12
LRR [sensitive, ls]	94	117	0.17
LRR [sensitive, ls]	94	117	3.4
LRR [sensitive, ls]	119	142	0.0014
LRR [sensitive, ls]	119	142	0.03
LRR [sensitive, ls]	143	164	0.016
LRR [sensitive, ls]	143	164	0.32
LRR [sensitive, ls]	167	190	0.071
LRR [sensitive, ls]	167	190	1.5
LRR [sensitive, ls]	191	214	0.00046
LRR [sensitive, ls]	191	214	0.0096
LRR [sensitive, ls]	240	263	0.035
LRR [sensitive, ls]	240	263	0.73
LRR [sensitive, ls]	264	287	0.49
LRR [sensitive, ls]	264	287	10
LRR [sensitive, ls]	288	311	0.00071
LRR [sensitive, ls]	288	311	0.015
LRR [sensitive, ls]	312	335	0.005
LRR [sensitive, ls]	312	335	0.1
LRR [sensitive, ls]	390	414	0.0014
LRR [sensitive, ls]	390	414	0.029
LRR [sensitive, ls]	438	461	0.065
LRR [sensitive, ls]	438	461	1.3
LRR [sensitive, ls]	462	486	0.33
LRR [sensitive, ls]	462	486	6.8
LRR [sensitive, ls]	487	510	0.12
LRR [sensitive, ls]	487	510	2.5
LRR [sensitive, ls]	511	534	0.3
LRR [sensitive, ls]	511	534	6.3
LRR [sensitive, ls]	535	558	1.2
LRR [sensitive, ls]	535	558	24
LRR [sensitive, ls]	559	582	8.7e-05
LRR [sensitive, ls]	559	582	0.0018
LRR [sensitive, ls]	583	606	0.55
LRR [sensitive, ls]	583	606	11
LRR [sensitive, ls]	607	629	0.18
LRR [sensitive, ls]	607	629	3.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	24	813	2e-85
FLS2 [A.thaliana]	27	625	2e-82
CLV2 [A. thaliana]	30	622	7e-53
Cf-9 [L. pimpinellifolium]	47	644	2e-57
CLV2 [A. thaliana]	73	531	8e-43
FLS2 [A.thaliana]	73	999	1e-132
CLV2 [A. thaliana]	147	623	5e-46
Pto [L. esculentum]	699	993	2e-39
Rpg1 [Hordeum vulgare]	710	999	3e-39
Rpg1 [Hordeum vulgare]	713	999	1e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	26	in -> out

Report for 2012.m00159

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)