Report for 2050.m00199

 > 2050.m00199, length: 774, copies: 1 

MAEPGHLAQLSALTTTVITCLILITPTPAAASGASCVASERDALAAFRASLLDPAGRLATWSGHSCCRWRGVHCD

GSTGHVVKLDLRNDLTVHSDTDWILFYEVRVDIDSSWVHSALALRNTGEMISSLAALHHLRYLDLSWNNFNDSSI

PLFMADLKNLRHLDMSWVDLSAVRDWVHTVNTLSSLKVLRLRGCKLESAISTMSHFNLTRLEVLDLSVNKFNASI

QQKWLWDHKGIKELYLTEGHWFGSIPDAFGNMSALQVMDLGHNNLMGTIPTTLQHLCDLQVVSLYDNYIDGDATE

FMERLPRCSWNKLREMDLHSTNLSGELPVWIGKLSSLDFVDLSHNTLTGELPVGFGALRNMIYLNLGWNNFTGQI

SEEHFSSLLNLKYLYLSGNSFKQMVFEEDWIPPFRLKVAHLRSCRLGPKFPSWLKWQTEIRVLDVSGTCISDSLP

VWFKTVFSQAYSLNLSDNQLCGTLPRTPEDMLAMVMDLGSNNLTGQVPRFPVNITYFDLSNNSLSGPLPSDLGAP

RLEELRLYSNYITGTIPAYFCQLRRLSNMFSGHIPEELTNSFGLHYLDLANNNISGIIPQSLAGMKAMRRTTPDG

NRGDVYEGSISSFTKSQELHYTFSNYNLVVLLDLSGNSLTGQIPEEISLLLGLKSLNLSGNHLGGKIPNTIGDLK

GLESLDLSRNRLSGEIPSSLSELTSFSWLNLSYNNLSGRIPSGHQLQTLNDQEYIYIGNPGLCGPPLRKNCAMRG

RHDEVDDVSDDLAVLYLGGVQAGQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	134	158	0.99
LRR [Pfam ls]	259	282	3.8
LRR [Pfam ls]	312	335	2
LRR [Pfam ls]	336	359	0.078
LRR [Pfam ls]	360	384	3.7
LRR [Pfam ls]	385	410	0.75
LRR [Pfam ls]	503	523	6.2
LRR [Pfam ls]	526	549	0.017
LRR [Pfam fs]	568	591	4.2e-05
LRR [Pfam ls]	568	591	0.00071
LRR [Pfam ls]	628	651	1.6
LRR [Pfam ls]	652	675	0.02
LRR [Pfam ls]	676	699	0.0028
LRR [Pfam ls]	700	722	2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	134	158	0.048
LRR [sensitive, ls]	134	158	0.99
LRR [sensitive, ls]	185	207	0.41
LRR [sensitive, ls]	185	207	8.5
LRR [sensitive, ls]	210	234	0.38
LRR [sensitive, ls]	210	234	7.9
LRR [sensitive, ls]	235	258	0.81
LRR [sensitive, ls]	235	258	17
LRR [sensitive, ls]	259	282	0.18
LRR [sensitive, ls]	259	282	3.8
LRR [sensitive, ls]	283	306	2.4
LRR [sensitive, ls]	283	306	50
LRR [sensitive, ls]	312	335	0.097
LRR [sensitive, ls]	312	335	2
LRR [sensitive, ls]	336	359	0.0038
LRR [sensitive, ls]	336	359	0.078
LRR [sensitive, ls]	360	384	0.18
LRR [sensitive, ls]	360	384	3.7
LRR [sensitive, ls]	385	410	0.037
LRR [sensitive, ls]	385	410	0.75
LRR [sensitive, ls]	434	457	0.62
LRR [sensitive, ls]	434	457	13
LRR [sensitive, ls]	459	482	1.6
LRR [sensitive, ls]	459	482	33
LRR [sensitive, ls]	503	523	0.3
LRR [sensitive, ls]	503	523	6.2
LRR [sensitive, ls]	526	549	0.00081
LRR [sensitive, ls]	526	549	0.017
LRR [sensitive, ls]	568	591	3.4e-05
LRR [sensitive, ls]	568	591	0.00071
LRR [sensitive, ls]	628	651	0.078
LRR [sensitive, ls]	628	651	1.6
LRR [sensitive, ls]	652	675	0.00097
LRR [sensitive, ls]	652	675	0.02
LRR [sensitive, ls]	676	699	0.00013
LRR [sensitive, ls]	676	699	0.0028
LRR [sensitive, ls]	700	722	0.099
LRR [sensitive, ls]	700	722	2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	40	738	1e-48
FLS2 [A.thaliana]	40	716	3e-50
Cf-9 [L. pimpinellifolium]	57	726	7e-44
FLS2 [A.thaliana]	122	739	2e-47
Xa21 [O. sativa]	122	395	1e-15
Xa21 [O. sativa]	189	751	2e-49
CLV2 [A. thaliana]	212	770	1e-34
FLS2 [A.thaliana]	241	739	8e-39
FLS2 [A.thaliana]	305	767	2e-32
Xa21 [O. sativa]	311	717	1e-25
CLV2 [A. thaliana]	312	717	6e-39
Xa21 [O. sativa]	542	716	5e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2050.m00199

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)