Report for 2108.m00090

 > 2108.m00090, length: 332, copies: 1 

MASTASFMLAVLLAVAVAAAPARAVRCPPSDKQALMRVKQSLGNPATLSTWSLASADCCEWDHVRCDEAGRVNNV

FIDGANDVRGQIPSAVAGLTALMSLSLFRLPGLSGPIPACLTALSNLQFLTISHTNVSGVIPDSLARIRSLDSVD

LSHNSLTGPIPNSFSDLPNLRSLDLRSNKLTGCIPAGLVQGQFRSLILSYNQLTGPIPRDDAQDEINTVDLSHNR

LTGDASFLFAAGRPIGKVDLSWNDLDFDLSKLVFPPELTYLDLSHNRIRGTVPRSLAALSTLQTLDLSYNRLCGP

LPRLHGVIRHGCKPYEHNQCAGGAPLGGCHQS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	121	144	0.47
LRR [Pfam ls]	145	168	0.0015
LRR [Pfam ls]	169	189	0.12
LRR [Pfam ls]	262	285	0.0074
LRR [Pfam ls]	286	305	5.1

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	121	144	0.023
LRR [sensitive, ls]	121	144	0.47
LRR [sensitive, ls]	145	168	7.1e-05
LRR [sensitive, ls]	145	168	0.0015
LRR [sensitive, ls]	169	189	0.0058
LRR [sensitive, ls]	169	189	0.12
LRR [sensitive, ls]	192	213	1
LRR [sensitive, ls]	192	213	22
LRR [sensitive, ls]	215	238	1.7
LRR [sensitive, ls]	215	238	35
LRR [sensitive, ls]	262	285	0.00036
LRR [sensitive, ls]	262	285	0.0074
LRR [sensitive, ls]	286	305	0.25
LRR [sensitive, ls]	286	305	5.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	302	5e-19
FLS2 [A.thaliana]	33	301	4e-23
Xa21 [O. sativa]	36	302	5e-18
FLS2 [A.thaliana]	70	302	5e-17
FLS2 [A.thaliana]	73	308	2e-20
Xa21 [O. sativa]	74	306	2e-14
Cf-9 [L. pimpinellifolium]	79	326	7e-12
Cf-9 [L. pimpinellifolium]	80	301	8e-19
Cf-9 [L. pimpinellifolium]	80	302	4e-12
CLV2 [A. thaliana]	80	301	2e-19
FLS2 [A.thaliana]	80	302	5e-20
Xa21 [O. sativa]	80	302	8e-13
CLV2 [A. thaliana]	81	322	1e-21
FLS2 [A.thaliana]	81	302	1e-21
FLS2 [A.thaliana]	81	309	5e-21
FLS2 [A.thaliana]	81	302	2e-18
Xa21 [O. sativa]	81	305	4e-15
Xa21 [O. sativa]	81	326	5e-15
Cf-9 [L. pimpinellifolium]	82	302	3e-13
Xa21 [O. sativa]	104	310	7e-14
CLV2 [A. thaliana]	107	302	5e-24
CLV2 [A. thaliana]	114	309	7e-18
Xa21 [O. sativa]	125	302	1e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2108.m00090

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)