Report for 2113.m00207

 > 2113.m00207, length: 805, copies: 1 

MARLDLSFNALRDGVPGEALGGLPGLEFLDLSMNHLSGGVPPSLAGAVGLRFLNLSNNALSGGIPDELRSLRALT

ELQISGNNLTGAIPPWLAALPALRILSAYENSLSGPIPSGLGLSSKLQVLNLHSNALEGAIPSSLFDLGNLQVLI

LTVNRLNGTIPDTIGRCSALSNVRIGNNRLAGAIPASIGDATSLTYFEADSNELTGGIPAQLARCANLTLLNLAY

NRLAGEVPDVLGELRSLQELIVSSNGLSGEFPRSILRCRNLSKLDLSYNAFRGGLPESVCNGSRLQFLLLDHNEF

SGGIPVGIGGCGRLLELQLGNNNLTGEIPAEIGRVKSLQIALNLSFNHLVGPLPRELGRLDKLVALDLSSNEISG

EIPGDMRGMLSLIEVNLSNNRLSGAIPVFAPFQKSAASSFSGNTKLCGNPLVVDCGPIYGSSYGMDHRKISYRVA

LAVVGSCVLIFSVVSLVVALFMWRERQEKEAEAKMAEAGEVVVAAPQVMASNMFIDSLQQAIDFQSCVKATFKDA

NVVSNGTFSITYKAVMPSGMVVCVKKLKSVDRAVIHHQTKMIWELECLSHINHPNLVRPIGYVIYEDVALLLHHH

MPNGTLLQLLHNVDNPDGDNQKPDWPRLLSIAIDVAEGLAFLHHVATIHLDISSGNVFLDSHYNALLGEVEISKL

LDPLKGTASISAVAGSFGYIPPEYAYTMQVTVPGNVYSFGVVLLEILTSKLPVDEEFGEGMDLVKWVHSAPARGE

TPEQIMDPKLSTVSFAWRKQMLAVLKVAMLCTERAPAKRPKMKKVVEMLQEAKNS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	25	48	6.3
LRR [Pfam ls]	49	72	0.0024
LRR [Pfam ls]	73	96	0.012
LRR [Pfam ls]	121	144	0.16
LRR [Pfam ls]	145	168	6.2
LRR [Pfam ls]	217	240	0.31
LRR [Pfam ls]	265	286	2.5
LRR [Pfam ls]	289	312	2.1
LRR [Pfam ls]	313	336	0.68
LRR [Pfam ls]	362	385	0.4
LRR [Pfam ls]	386	408	0.36
Ser/Thr pkinase [Pfam fs]	522	731	2.9e-19
Ser/Thr pkinase [Pfam ls]	522	801	2.7e-15

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	1	24	1.7
LRR [sensitive, ls]	1	24	36
LRR [sensitive, ls]	25	48	0.3
LRR [sensitive, ls]	25	48	6.3
LRR [sensitive, ls]	49	72	0.00012
LRR [sensitive, ls]	49	72	0.0024
LRR [sensitive, ls]	73	96	0.0006
LRR [sensitive, ls]	73	96	0.012
LRR [sensitive, ls]	97	120	1.1
LRR [sensitive, ls]	97	120	22
LRR [sensitive, ls]	121	144	0.0077
LRR [sensitive, ls]	121	144	0.16
LRR [sensitive, ls]	145	168	0.3
LRR [sensitive, ls]	145	168	6.2
LRR [sensitive, ls]	169	192	4.3
LRR [sensitive, ls]	169	192	89
LRR [sensitive, ls]	193	216	1.2
LRR [sensitive, ls]	193	216	24
LRR [sensitive, ls]	217	240	0.015
LRR [sensitive, ls]	217	240	0.31
LRR [sensitive, ls]	241	264	0.36
LRR [sensitive, ls]	241	264	7.4
LRR [sensitive, ls]	265	286	0.12
LRR [sensitive, ls]	265	286	2.5
LRR [sensitive, ls]	289	312	0.1
LRR [sensitive, ls]	289	312	2.1
LRR [sensitive, ls]	313	336	0.033
LRR [sensitive, ls]	313	336	0.68
LRR [sensitive, ls]	362	385	0.019
LRR [sensitive, ls]	362	385	0.4
LRR [sensitive, ls]	386	408	0.017
LRR [sensitive, ls]	386	408	0.36

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	431	3e-50
Cf-9 [L. pimpinellifolium]	1	402	2e-34
Xa21 [O. sativa]	3	162	1e-10
CLV2 [A. thaliana]	4	329	7e-32
FLS2 [A.thaliana]	4	402	2e-62
Xa21 [O. sativa]	4	621	8e-63
FLS2 [A.thaliana]	5	183	5e-19
FLS2 [A.thaliana]	9	803	7e-95
CLV2 [A. thaliana]	23	418	1e-49
CLV2 [A. thaliana]	26	425	5e-48
CLV2 [A. thaliana]	29	399	4e-47
Xa21 [O. sativa]	29	403	9e-57
Xa21 [O. sativa]	74	403	2e-46
CLV2 [A. thaliana]	77	424	5e-46
CLV2 [A. thaliana]	113	403	1e-24
Xa21 [O. sativa]	289	402	1e-13
Pto [L. esculentum]	500	802	3e-26
Rpg1 [Hordeum vulgare]	511	799	9e-18
Rpg1 [Hordeum vulgare]	512	801	3e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End
putative coiled-coil	475	495

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	449	471	out -> in

Report for 2113.m00207

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)