Report for 2114.m00191

 > 2114.m00191, length: 808, copies: 2 

MTMKVTTATAHFLLVFLASTISHSVICSALGNETDQLSSLLEFKNAISLDPEQSLISWNSSNHLCSWEGVSCSSK

NPPRVTAIDLVGLVGRISPSLGNLTFLRNLSLATNRFTGQIPASLGRLRRLRSLYLSNNTLQGTIPSFANCSELR

ALFLDGNELAGGLPGAGDLPVGIEALVLSSNRLAGTIPPSLGNVTTLRKLACMNNGVGGGIPGELAALRGMEVLA

VDGNRLSGGFPVAVMNMSGLAVLGLSTNGFTGELPSGIGGFLPKLRQLTIGGNFFQGNIPSSLANASNLFKLGMS

DNNFTGVVPASIGKLAKLTLLNLEMNQLHARSKQEWEFMDNLANCTELQVLSLEKNQMEGQVPSSLGNFSVQLQY

LYLGLNRLSGSFPSGIANLPNLIILALDDNWFTGSVPQWLGGLKTLQSLTVSYNNFTGCENLQHIELDHNNLSGG

IPPSFGKLISLKFLNLSHNKLTGSIPMLLGDLQLLEQIDLSFNHLRGEVPTKAQRLNIVVDVSDALAYLHHNHQG

PIIHCDLKPSNILLDDSMTAHVGDFGLARFKIDSKTSLGNSVSTSSFTINGTIGYVAPECAIGGQVSTAADVYSF

GVVLLEIFIRKRPTDDMFKDGLSIAKYADINIPDRLLQIVDPQLVQELSLNQEDPVATDENAAHCLLSVLNIGLC

CTKSSPNERISMQEGSVLLDMEQRVLMEEIVTLLPVERAVATTRFVLGLLRTDMILHTGVACRDALEMRASKQLK

EATHEDLLIPNTGNFVETLYDVDCMERMLEQFIVTVHELVGVRSPVRLATDIGRRLGG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	125	147	4.1e-05
LRR [Pfam ls]	125	147	0.00072
LRR [Pfam ls]	172	195	3.2
LRR [Pfam ls]	269	292	4.6
LRR [Pfam ls]	293	316	4.3
LRR [Pfam ls]	347	370	4.2
LRR [Pfam ls]	372	395	0.3
LRR [Pfam ls]	396	419	4.9
Ser/Thr pkinase [Pfam ls]	430	694	3.9e-11
LRR [Pfam ls]	436	459	0.0016
LRR [Pfam ls]	460	483	0.012
Ser/Thr pkinase [Pfam fs]	492	616	2.3e-27

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	101	124	0.35
LRR [sensitive, ls]	101	124	7.2
LRR [sensitive, ls]	125	147	3.5e-05
LRR [sensitive, ls]	125	147	0.00072
LRR [sensitive, ls]	148	170	0.37
LRR [sensitive, ls]	148	170	7.5
LRR [sensitive, ls]	172	195	0.15
LRR [sensitive, ls]	172	195	3.2
LRR [sensitive, ls]	196	219	4.3
LRR [sensitive, ls]	196	219	90
LRR [sensitive, ls]	220	243	2
LRR [sensitive, ls]	220	243	40
LRR [sensitive, ls]	244	268	0.46
LRR [sensitive, ls]	244	268	9.5
LRR [sensitive, ls]	269	292	0.22
LRR [sensitive, ls]	269	292	4.6
LRR [sensitive, ls]	293	316	0.21
LRR [sensitive, ls]	293	316	4.3
LRR [sensitive, ls]	347	370	0.2
LRR [sensitive, ls]	347	370	4.2
LRR [sensitive, ls]	372	395	0.014
LRR [sensitive, ls]	372	395	0.3
LRR [sensitive, ls]	396	419	0.24
LRR [sensitive, ls]	396	419	4.9
LRR [sensitive, ls]	436	459	7.5e-05
LRR [sensitive, ls]	436	459	0.0016
LRR [sensitive, ls]	460	483	0.0006
LRR [sensitive, ls]	460	483	0.012
LRR [sensitive, ls]	484	507	0.74
LRR [sensitive, ls]	484	507	15

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	9	569	9e-39
FLS2 [A.thaliana]	16	578	4e-61
FLS2 [A.thaliana]	26	508	2e-52
Cf-9 [L. pimpinellifolium]	35	572	5e-42
CLV2 [A. thaliana]	38	607	2e-46
FLS2 [A.thaliana]	38	500	5e-64
Xa21 [O. sativa]	39	568	1e-77
CLV2 [A. thaliana]	50	475	2e-34
FLS2 [A.thaliana]	87	689	2e-53
CLV2 [A. thaliana]	88	528	6e-35
CLV2 [A. thaliana]	88	413	1e-26
CLV2 [A. thaliana]	88	313	3e-13
Xa21 [O. sativa]	88	501	4e-54
Xa21 [O. sativa]	90	311	7e-23
Xa21 [O. sativa]	90	236	3e-12
Pto [L. esculentum]	493	706	5e-16
Rpg1 [Hordeum vulgare]	508	611	6e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	12	34	in -> out

Report for 2114.m00191

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)