Report for 2218.m00051

 > 2218.m00051, length: 1148, copies: 2 

MARKIKDIKVKYNEIVRQRRDANTIRSSLQVDQPIPSSNMIIGELSLLSNVEESKIPIRDQEMDTIVSMLVDSNE

GENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVR

EISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQDRSIGSRILLTTRDRKVAEVVKSKQIHELVFLTESESWSLF

LKCSGWVEDDLGSEFIQLGKEILKKCGGVPLAIRTIAGVLCEKREISTWRAIRGSDLWNVGSVNDRVFASLKLSY

IHLADKLKQCFTFCSIFPKGYVINKDRLVAQWIAHGFITPMKEEQPKDIASEYFDSLVKAGFFLQDTIEEFGYLH

KMHDLIHDLAQYCEKNEVVTSRPNSMSTYQTHKCRYLSLTSGNEKVKRGLLDKVHALYMSDGNLSFDKPVKKSCY

IRSVILDNENCTTFPPVLLKFEFLGYLEIHGVDCKKLPEAISGCWNLQSLHFIRCSGFVMLPESVGKLKKLRTLE

LNYVIDLESLPQSIGDCQGLQSLQLHSCNKLQGMPTSIGRIENLRVLHITSCPCMQKLPSEPCGESNNLEIINLS

NCHNFHGLPSTFACKALRTLNLYNTKITMLPQWVTSIDTLECLDLGYCHELMEFPKGIANLRRLAVLNLEGCSKL

RCMPSGFRQLTRLTKMGLFVVGCDGDNARISELETLDMISGKMKIINLKYTLDPTDADKASLKRKNNIKYLELDW

SRGETEKELVTDMVMEQDLAVLNALEPPSRIEEILIYYYGGPCLPWWMKKQTDSSCWESTMLKQTNPCQLIYLTR

MTLHEIPNLKHMQGLVELPLLNYLELFGLPNLEDMWTTTGGAEIRGDELQAKYCFPALSTLWIRGCPRLNVVPYF

PSSLERLFLRESNDQLLSSGSFSHLLPPLAHESSPCSNAHSAVPRLKELTIIKMTGSSCGWDFLQYLDALEYFNI

FGSNDLTQLPESMRSLTSLHKLIIHDCPTFGMLPEWLGELCSLQSLFIKGTPMMDSLPQSIGCLTSLTHLTIACD

NLKQLPETFHHLTSLRELDLAGCGALTALPENIGKLSALEALYVGPCSAIQCLPESIKHLTNLRRLNISGCPNLV

KRCEQEVGEDWQLVSHIPNLISD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
NB-ARC [Pfam fs]	40	343	5.3e-52
NB-ARC [Pfam ls]	40	343	7.9e-52
LRR [Pfam ls]	593	615	4.2
LRR [Pfam ls]	663	686	0.74
LRR [Pfam ls]	1041	1063	4.6
LRR [Pfam ls]	1064	1087	0.052

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	496	519	2.4
LRR [sensitive, ls]	496	519	49
LRR [sensitive, ls]	520	543	2.2
LRR [sensitive, ls]	520	543	45
LRR [sensitive, ls]	544	567	1.6
LRR [sensitive, ls]	544	567	33
LRR [sensitive, ls]	568	592	0.69
LRR [sensitive, ls]	568	592	14
LRR [sensitive, ls]	593	615	0.21
LRR [sensitive, ls]	593	615	4.2
LRR [sensitive, ls]	616	638	0.72
LRR [sensitive, ls]	616	638	15
LRR [sensitive, ls]	639	662	0.54
LRR [sensitive, ls]	639	662	11
LRR [sensitive, ls]	663	686	0.036
LRR [sensitive, ls]	663	686	0.74
LRR [sensitive, ls]	969	992	2.1
LRR [sensitive, ls]	969	992	43
LRR [sensitive, ls]	993	1016	2.8
LRR [sensitive, ls]	993	1016	56
LRR [sensitive, ls]	1017	1040	2.6
LRR [sensitive, ls]	1017	1040	53
LRR [sensitive, ls]	1041	1063	0.23
LRR [sensitive, ls]	1041	1063	4.6
LRR [sensitive, ls]	1064	1087	0.0026
LRR [sensitive, ls]	1064	1087	0.052
LRR [sensitive, ls]	1112	1140	1.6
LRR [sensitive, ls]	1112	1140	31

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Mla1 [Hordeum vulgare].	1	670	5e-35
Xa1 [Oryza sativa]	13	583	8e-48
N [N. glutinosa]	17	688	7e-23
I2 [L. esculentum]	52	1143	4e-63
Pib [Oryza sativa].	52	546	2e-30
RPS2 [A. thaliana]	55	653	5e-30
Pi-ta [Oryza sativa]	59	574	4e-24
M [L. usitatissimum]	60	1124	1e-19
L6 [L. usitatissimum]	73	1124	6e-18
RPP5 [A. thaliana]	75	1081	7e-15
RPM1 [A. thaliana]	81	700	2e-40
RPP5 [A. thaliana]	457	689	1e-12
RPP5 [A. thaliana]	485	713	1e-10
RPP5 [A. thaliana]	608	1124	1e-20
Xa1 [Oryza sativa]	630	1121	5e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2218.m00051

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)