Report for 2218.m00053

 > 2218.m00053, length: 930, copies: 1 

MVKRRLFLLLFLCLLAGSRIASADTNPQDAAALRSLMKKWTKNVPASWRKSNDPCARWDGITCDRNSRVTSLNLF

GMNLEGTLSDDIGNLTELTVLDLSSNRGLGGTLTPAIGKLANLRILALIGCSFSGNVPSELGNLSQLDFLGLNSN

QFTGKIPPSLGKLSKVTWLDLADNQLTGPIPNSRDHGSGFDQLLKAQHFHLNKNKLQGSVPDFLFNSSMDVKHIL

FDRNNFNGSIPASIGVLPKLEVLRLNDNAFTGPVPAMNNLTKLHVLMLSNNKLSGLMPNLTGMDMLENVDLSNNS

FIPSEVPSWFTSLIKLMTLKMQSVGLSGQLPQKLFSNPNLQYVVLSDNQLNGVLDMGNISDELHVDICYFSVARL

AGNPVCGDSLLSSMKPCTDLTTEPLHKPPSIDVQCANPFVETIVFRAPSFGDVVKFLPSLQANLSSKLNSCTPNN

LGLVYSNDDAYLNVDIRACPVNQKRFNYSQVLNCFNLTLQTYKPPEIFGPYYVKAHPYPFHDKTSRAVLIGVVTG

SLLLVIGLTLVGVYAVRQKKRAQKLVSINDPFASWGSMGQDIGEAPKIKSARCFTLEDLKLSTNDFREINAIGAG

GYGTVYRGKLPDGQLIAIKRSKQGSMQGGLEFKTEIELLSRVHHKNLVGLVGFCFEKGERMLVYEFIPNGTLSEA

LYGIKGVQLDWSRRLKIALDSARGLAYLHDHADPPIIHRDVKSTNILLDERMTAKVADFGLSLLVSDSEEGQFCT

NVKGTLGYLDPEYYMTQQLTAKSDVYSFGVVLLELIVAQPPIHKQKYIVREVKTALDMGDQTYCGLKDVMDPVLQ

KTGDLRGFARFLKLALQCVEDLGTDRPSMNTIVREIEVIMQDNGIRTGMSSTSSSFSIDSRTMMAAPKYPYSNAS

TSSTAFDMDSRAFEYSGKFPSEGSLKNRGT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	68	91	5.7
LRR [Pfam ls]	92	116	2.5
LRR [Pfam ls]	141	164	0.66
LRR [Pfam ls]	165	184	8.9
LRR [Pfam ls]	244	266	0.66
LRR [Pfam ls]	267	286	0.19
Ser/Thr pkinase [Pfam fs]	591	785	1.3e-48
Ser/Thr pkinase [Pfam ls]	591	863	1.5e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	68	91	0.28
LRR [sensitive, ls]	68	91	5.7
LRR [sensitive, ls]	92	116	0.12
LRR [sensitive, ls]	92	116	2.5
LRR [sensitive, ls]	117	140	0.6
LRR [sensitive, ls]	117	140	12
LRR [sensitive, ls]	141	164	0.033
LRR [sensitive, ls]	141	164	0.66
LRR [sensitive, ls]	165	184	0.44
LRR [sensitive, ls]	165	184	8.9
LRR [sensitive, ls]	195	218	2
LRR [sensitive, ls]	195	218	41
LRR [sensitive, ls]	220	243	1.6
LRR [sensitive, ls]	220	243	33
LRR [sensitive, ls]	244	266	0.033
LRR [sensitive, ls]	244	266	0.66
LRR [sensitive, ls]	267	286	0.0097
LRR [sensitive, ls]	267	286	0.19
LRR [sensitive, ls]	290	314	1.1
LRR [sensitive, ls]	290	314	21
LRR [sensitive, ls]	339	360	1.1
LRR [sensitive, ls]	339	360	22
LRR [sensitive, ls]	580	601	6.4
LRR [sensitive, ls]	580	601	130

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	6	398	1e-26
CLV2 [A. thaliana]	7	356	1e-25
Xa21 [O. sativa]	27	352	3e-24
Cf-9 [L. pimpinellifolium]	47	352	1e-25
FLS2 [A.thaliana]	58	363	2e-32
Xa21 [O. sativa]	65	367	5e-28
Cf-9 [L. pimpinellifolium]	67	366	3e-17
CLV2 [A. thaliana]	68	301	4e-15
FLS2 [A.thaliana]	69	861	5e-75
CLV2 [A. thaliana]	71	354	1e-19
Cf-9 [L. pimpinellifolium]	72	361	3e-18
CLV2 [A. thaliana]	72	354	8e-28
CLV2 [A. thaliana]	79	415	2e-15
FLS2 [A.thaliana]	79	361	6e-23
Xa21 [O. sativa]	79	285	2e-17
Rpg1 [Hordeum vulgare]	577	864	2e-37
Pto [L. esculentum]	579	866	1e-53
Rpg1 [Hordeum vulgare]	579	864	3e-27

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	517	539	out -> in

Report for 2218.m00053

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)