Report for 2337.m00119

 > 2337.m00119, length: 1066, copies: 1 

MGILGSFLVLLLLAAPAFGQLPSQDILALLAFKKGITHDPAGFITDSWNDESIDFNGCPASWNGIVCNGANVAGV

VLDGHGISGVADLSVFVNLTMLVKLSMANNNLSGSLPSNVGSLKSLKFMDISNNRFSGPIPDNIGNLRSLQNLSL

ARNNFSGPLPDSIDGLASLQSLDVSGNSLSGPLPSSLKGLRSMVALNLSYNAFTKGIPSGLGLLVNLQSLDLSWN

QLEGGVDWKFLIESTVAHVDFSGNLLTSTTPKELKFLADISETVLYLNLSNNKLTGSLIDGVELSTFGRLKVLDL

SHNQLSGDLPGFNYVYDLEVLRLANNAFTGFVPSGLLKGDSLVLSELDLSANNLTGHINMITSTTLQVINLSSNA

LFGDLPMLAGSCTVLDLSNNKFKGNLSVIAKWSNDLEYVDLSQNNLTGTIPDVSSQFLRLNYLNLSHNSLADTIP

EAVVQYPKLTVLDLSSNQFRGPIPANLLTSSMLQELYIHDNMLSGGLSFPGSSSKNLSLQVLDISGNHFNGSLPD

EIASLSSLQALDISTNNFSGPLPASITKLAALTALDISINQFTGSLPDALPDTLQSFNASYNDLSGVVPVNLRKF

PESSFHPGNSRLDYPASSSGSGSSSGSAGGRSLSAAAKIALIAASIVALVILILVAIVCHYKQISRQFPSSEKVS

DKNLHKTSKDMASTKGKDDKGGLVVSADELGAPRKGSTSEALSQEEKLSGVGGFSPSKGSRFSWSPDSGEAYTQE

GLARLDVRSPDRLAGELHFLDETITLTPEELSRAPAEVLGRSSHGTSYRATLENGVFLTVKWLREGVARPKKEFS

KEAKKFANIRHPNVVGLRGYYWGPTAHEKLILSDYVSPGSLASFLYADRPGRRGPPLTWAQRLKIAVDVARGLNY

LHFDRAMPHGNLKATNILLDGLDLNARVADYCLHRLMTQAGVVEQILDLGVLGYRAPELAASKKPSPSFKSDVYA

FGVVLLELLTGRCAGDVVSGSEGGVDLTDWVRLRVAEGRGSDCFDPAMASDSENQVSVKGMKDVLGIALRCIRPV

SERPGIKSVYEDLSSI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	96	119	4.3
LRR [Pfam ls]	120	143	0.16
LRR [Pfam ls]	144	167	0.36
LRR [Pfam ls]	168	191	0.0056
LRR [Pfam ls]	192	215	7.3
LRR [Pfam ls]	268	291	8
LRR [Pfam ls]	294	316	0.43
LRR [Pfam ls]	317	341	5.8
LRR [Pfam ls]	386	408	8
LRR [Pfam ls]	410	433	1.8
LRR [Pfam ls]	434	457	3.2
LRR [Pfam ls]	458	479	0.99
LRR [Pfam ls]	508	531	0.02
LRR [Pfam ls]	532	555	7.1
Ser/Thr pkinase [Pfam ls]	783	1065	9.3e-13
Ser/Thr pkinase [Pfam fs]	817	992	6.4e-18

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	96	119	0.21
LRR [sensitive, ls]	96	119	4.3
LRR [sensitive, ls]	120	143	0.0077
LRR [sensitive, ls]	120	143	0.16
LRR [sensitive, ls]	144	167	0.018
LRR [sensitive, ls]	144	167	0.36
LRR [sensitive, ls]	168	191	0.00028
LRR [sensitive, ls]	168	191	0.0056
LRR [sensitive, ls]	192	215	0.36
LRR [sensitive, ls]	192	215	7.3
LRR [sensitive, ls]	216	236	0.54
LRR [sensitive, ls]	216	236	11
LRR [sensitive, ls]	240	263	2.6
LRR [sensitive, ls]	240	263	53
LRR [sensitive, ls]	268	291	0.4
LRR [sensitive, ls]	268	291	8
LRR [sensitive, ls]	294	316	0.021
LRR [sensitive, ls]	294	316	0.43
LRR [sensitive, ls]	317	341	0.29
LRR [sensitive, ls]	317	341	5.8
LRR [sensitive, ls]	343	370	1.8
LRR [sensitive, ls]	343	370	36
LRR [sensitive, ls]	386	408	0.4
LRR [sensitive, ls]	386	408	8
LRR [sensitive, ls]	410	433	0.087
LRR [sensitive, ls]	410	433	1.8
LRR [sensitive, ls]	434	457	0.16
LRR [sensitive, ls]	434	457	3.2
LRR [sensitive, ls]	458	479	0.049
LRR [sensitive, ls]	458	479	0.99
LRR [sensitive, ls]	482	504	1.5
LRR [sensitive, ls]	482	504	30
LRR [sensitive, ls]	508	531	0.00098
LRR [sensitive, ls]	508	531	0.02
LRR [sensitive, ls]	532	555	0.35
LRR [sensitive, ls]	532	555	7.1
LRR [sensitive, ls]	556	576	0.65
LRR [sensitive, ls]	556	576	13
LRR [sensitive, ls]	578	601	0.46
LRR [sensitive, ls]	578	601	9.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	599	9e-69
Cf-9 [L. pimpinellifolium]	3	581	4e-41
CLV2 [A. thaliana]	11	601	5e-54
Xa21 [O. sativa]	25	572	3e-53
Xa21 [O. sativa]	42	231	6e-18
Xa21 [O. sativa]	53	497	5e-42
Cf-9 [L. pimpinellifolium]	68	495	7e-39
FLS2 [A.thaliana]	71	308	2e-11
Cf-9 [L. pimpinellifolium]	91	622	5e-47
FLS2 [A.thaliana]	92	467	5e-35
Cf-9 [L. pimpinellifolium]	93	598	4e-43
FLS2 [A.thaliana]	93	676	8e-60
Cf-9 [L. pimpinellifolium]	385	617	6e-11
CLV2 [A. thaliana]	416	604	3e-15
FLS2 [A.thaliana]	778	1066	6e-20
Rpg1 [Hordeum vulgare]	786	987	7e-12
Rpg1 [Hordeum vulgare]	788	1066	5e-19
Pto [L. esculentum]	789	1059	5e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	639	661	out -> in

Report for 2337.m00119

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)