Report for 2430.m00159

 > 2430.m00159, length: 1052, copies: 1 

MPGRVTVLDLSSCQLDGLIPPCIANLSSIERLDLSNNSFHGRIPAELSRLEQLRHLNLSVNSLDGRIPAELSSCS

RLEVLSLWNNSLQGEIPASLAQLVHIQLIDLSNNKLQGSIPSGFGTLRELKILNLATNTLVGNIPWLLGSGSSLT

YVDLGGNGLSEGIPEFLANSSSLQFLSLTQNKLTGALPRALFNTSSLTAIYLDRNKLIGSIPPVTAVAAPIQYLS

LAENNLTSEIPASIGNLSSLVGVSLAANNLVGSIPESLSRIPTLEMLILSINNLSGQVPQSIFNISSLKYLELAN

NSLIGRLPPDIGYKLPNLQRLILSKTRLSGPIPASLVNASKLEIIHLVDIGLTGILPSFGSLSHLQQLDLAYNQL

EAGDWSFLSSLANCTQLQRLCLDGNGLQGHLPSSVGNLPSELKWLWLKQNKLSGTIPLEIGNLRSLEVLYMDQNL

FTGTIPPSVGNLSNLLVLSFAQNNLSGHVPDSIGNLVKLTELYLDGNNFSGTIPASLGQWRHLEKLNLSHNSFGG

SIPSEVFNISSLSQSLDLSHNSFAGPIPLEIGGLINLGSLSISNNRLTSNIPSTLGKCVLLESLHMEENLLVGSI

PHFLMNLRSIKELDLSSNNLSGSIPDFFASMNYLKDLNLSFNDFDGPVPSTGIFRNASRVSLQGNDGLCANTPEL

GLPHCPALDRRTKHKSIILMIVVPIAAIVLVISLICLLTVCLKRREEKPILTDISMDTKIISYKDIVQATKGFST

ENLVGSGSFGDVYKGTLELEVDLVAIKVFNLNRHGGPSSFIAECEALKNIRHRNLVKVITLCSTLDPKGEEFKAI

IFQYMPNGSLETWLHQKVYDHNQKQVLTLGDRISIALDIAYALDYLHNQSASPLIHCDLKPSNVLLDLQMTAYVS

DFGLARFMCTTTAACANSTSLADLKGSIGYIAPEYGMGGPISTKGDAYSYGVLLLEILTGKRPSDDKLKDGLSLH

ELVESAFPHKLDEILDPIMLQSDLNGGKYHTEIMQSCIIPMVKLGLLCSSISPKDRLGMSQVSAEMGTIRQSFLE

LQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	4	27	0.57
LRR [Pfam ls]	28	51	0.085
LRR [Pfam ls]	52	75	0.61
LRR [Pfam ls]	76	99	0.17
LRR [Pfam ls]	100	123	0.0023
LRR [Pfam ls]	148	171	0.66
LRR [Pfam ls]	172	195	3.2
LRR [Pfam ls]	220	243	4.1
LRR [Pfam ls]	292	316	0.08
LRR [Pfam ls]	317	340	6.2
LRR [Pfam ls]	364	390	5.6
LRR [Pfam ls]	391	414	0.098
LRR [Pfam ls]	416	439	2.3
LRR [Pfam ls]	440	463	0.12
LRR [Pfam ls]	464	487	5.7
LRR [Pfam ls]	488	511	0.035
LRR [Pfam ls]	512	536	0.028
LRR [Pfam ls]	561	584	0.83
LRR [Pfam ls]	609	632	0.007
Ser/Thr pkinase [Pfam fs]	748	966	6.7e-50
Ser/Thr pkinase [Pfam ls]	748	1042	4.7e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	4	27	0.027
LRR [sensitive, ls]	4	27	0.57
LRR [sensitive, ls]	28	51	0.0041
LRR [sensitive, ls]	28	51	0.085
LRR [sensitive, ls]	52	75	0.029
LRR [sensitive, ls]	52	75	0.61
LRR [sensitive, ls]	76	99	0.0081
LRR [sensitive, ls]	76	99	0.17
LRR [sensitive, ls]	100	123	0.00011
LRR [sensitive, ls]	100	123	0.0023
LRR [sensitive, ls]	124	146	3.7
LRR [sensitive, ls]	124	146	76
LRR [sensitive, ls]	148	171	0.032
LRR [sensitive, ls]	148	171	0.66
LRR [sensitive, ls]	172	195	0.15
LRR [sensitive, ls]	172	195	3.2
LRR [sensitive, ls]	196	219	1
LRR [sensitive, ls]	196	219	21
LRR [sensitive, ls]	220	243	0.2
LRR [sensitive, ls]	220	243	4.1
LRR [sensitive, ls]	244	267	1.5
LRR [sensitive, ls]	244	267	32
LRR [sensitive, ls]	268	291	1.1
LRR [sensitive, ls]	268	291	22
LRR [sensitive, ls]	292	316	0.0038
LRR [sensitive, ls]	292	316	0.08
LRR [sensitive, ls]	317	340	0.3
LRR [sensitive, ls]	317	340	6.2
LRR [sensitive, ls]	341	363	1.2
LRR [sensitive, ls]	341	363	24
LRR [sensitive, ls]	364	390	0.27
LRR [sensitive, ls]	364	390	5.6
LRR [sensitive, ls]	391	414	0.0047
LRR [sensitive, ls]	391	414	0.098
LRR [sensitive, ls]	416	439	0.11
LRR [sensitive, ls]	416	439	2.3
LRR [sensitive, ls]	440	463	0.0057
LRR [sensitive, ls]	440	463	0.12
LRR [sensitive, ls]	464	487	0.27
LRR [sensitive, ls]	464	487	5.7
LRR [sensitive, ls]	488	511	0.0017
LRR [sensitive, ls]	488	511	0.035
LRR [sensitive, ls]	512	536	0.0013
LRR [sensitive, ls]	512	536	0.028
LRR [sensitive, ls]	537	560	4.9
LRR [sensitive, ls]	537	560	100
LRR [sensitive, ls]	561	584	0.04
LRR [sensitive, ls]	561	584	0.83
LRR [sensitive, ls]	585	608	0.45
LRR [sensitive, ls]	585	608	9.4
LRR [sensitive, ls]	609	632	0.00034
LRR [sensitive, ls]	609	632	0.007
LRR [sensitive, ls]	633	658	2.4
LRR [sensitive, ls]	633	658	50

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	142	2e-12
Xa21 [O. sativa]	2	529	3e-78
Cf-9 [L. pimpinellifolium]	3	668	5e-69
FLS2 [A.thaliana]	3	1045	1e-162
CLV2 [A. thaliana]	4	332	5e-40
CLV2 [A. thaliana]	8	527	5e-53
Xa21 [O. sativa]	8	294	3e-32
RPP5 [A. thaliana]	16	554	2e-12
CLV2 [A. thaliana]	80	673	7e-61
Xa21 [O. sativa]	154	859	1e-157
FLS2 [A.thaliana]	193	649	2e-62
CLV2 [A. thaliana]	194	636	1e-47
CLV2 [A. thaliana]	267	651	8e-46
Xa21 [O. sativa]	414	639	1e-25
Xa21 [O. sativa]	541	666	8e-13
Rpg1 [Hordeum vulgare]	733	961	8e-24
Pto [L. esculentum]	739	1037	3e-26
Rpg1 [Hordeum vulgare]	745	961	1e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	691	713	out -> in

Report for 2430.m00159

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)