Report for 2456.m00162

 > 2456.m00162, length: 1091, copies: 3 

MCQWRGVACGLSGRRTGRVVALDLTKLNLVGAISPLLGNLTYLRRLHLHKNRLHGEIPSELGHLRDLRHLNRSYN

SIQGPIPATLSTCRGMENIWLYSNKLQGQIPSEFGSLQNLQALVLGENRLTGSIPSFIGSLANLKFLILEENNFT

GEIPSDIGRLANLTVLGLGSNQLSGPIPASIGNLSALQFLSVFSNNLVGSIPPMQRLSSLEFFELGKNNIEGSIP

TWLGNLSSLLTVKLGGNRLDGNIPESLGKLKLLTSLDLSSNNLVGPVPDTIGNLYSIKQFHVENNELEGSLPSSI

FNLSSLEELNLQTNNLNGTIPLDLGNRLPKLQLFLISENQFHGSIPPSLCNISTLRWIQTVNNSLSGTIPQCIGI

NQKSLYSVTFAVNQFETSNKYGWSFMSSLTNCSNLRLLDVGDNKLTGELPNSIGNLSTRLEYFVTNYNSMTGKIP

EGLGNLVSLKFIEMNNNFYEGTIPDSLGKLKNLNRLYLTNNNLSGSIPSSIGNLRMLTLLSVAGNALSGEIPPSL

SNCPLEQLKLSYNNLTGLIPKELFAISVLSTSLILDHNFITGPLPSEVGNLTNLALLDFSSNLISGEIPSSIGEC

QSLQYLNTSGNLLQGQIPPSLDQPKGLLLLDLSHNNLSGSIPKFLGTMTGLASLNLSFNNFEGDVPKDGIFSNAT

PALIEGNNGLCNGIPQLKLPPCSHQTTKHKKQTWKIAMAISICSTVLFMAVVATSFVFHKRAKKTNANRQTSLIK

EQHMRVSYTELAEATKGFTSENLIGAGSFGSVYKGRMKINDQQVAVAVKVFNLKQRGSSKSFAAECETLRCVRHR

NLVKVLTVCSSIDFQGRDFKAIVYKFLPNRNLDQWLHQNIMEDGEHKALDLITRLEIAIDVASSLEYLHQYKASP

IIHCDLKPSNVLLDDEMVAHVGDFGLARFLHQDPEQSSGWASMRGTTGYAAPEYGLGNEVSIHGDVYSYGILLLE

MFSGKRPTDSEFGESLGLHNYVNMALPDRTASVIDLSLLEETVDGEAKTSKSNQTREMRIACITSILHVGVSCSV

ETPTDRMPIGDALKELQRIRDKFHRELQGAGATNHQDIQIC

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	42	65	0.19
LRR [Pfam ls]	90	113	2.4
LRR [Pfam ls]	114	137	1.3
LRR [Pfam ls]	138	161	0.25
LRR [Pfam ls]	162	185	0.12
LRR [Pfam ls]	209	232	1.8
LRR [Pfam ls]	257	280	0.33
LRR [Pfam ls]	305	329	0.33
LRR [Pfam ls]	409	432	0.013
LRR [Pfam ls]	482	505	0.0087
LRR [Pfam ls]	578	601	1.2
LRR [Pfam ls]	626	649	0.053
LRR [Pfam ls]	650	675	5.9
Ser/Thr pkinase [Pfam fs]	768	996	7.8e-41
Ser/Thr pkinase [Pfam ls]	768	1068	3.2e-35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	18	41	1.7
LRR [sensitive, ls]	18	41	36
LRR [sensitive, ls]	42	65	0.009
LRR [sensitive, ls]	42	65	0.19
LRR [sensitive, ls]	66	89	4.3
LRR [sensitive, ls]	66	89	88
LRR [sensitive, ls]	90	113	0.12
LRR [sensitive, ls]	90	113	2.4
LRR [sensitive, ls]	114	137	0.064
LRR [sensitive, ls]	114	137	1.3
LRR [sensitive, ls]	138	161	0.012
LRR [sensitive, ls]	138	161	0.25
LRR [sensitive, ls]	162	185	0.006
LRR [sensitive, ls]	162	185	0.12
LRR [sensitive, ls]	186	208	0.47
LRR [sensitive, ls]	186	208	9.7
LRR [sensitive, ls]	209	232	0.084
LRR [sensitive, ls]	209	232	1.8
LRR [sensitive, ls]	233	256	0.44
LRR [sensitive, ls]	233	256	9.1
LRR [sensitive, ls]	257	280	0.016
LRR [sensitive, ls]	257	280	0.33
LRR [sensitive, ls]	281	304	0.48
LRR [sensitive, ls]	281	304	9.9
LRR [sensitive, ls]	305	329	0.016
LRR [sensitive, ls]	305	329	0.33
LRR [sensitive, ls]	330	353	0.6
LRR [sensitive, ls]	330	353	12
LRR [sensitive, ls]	409	432	0.00064
LRR [sensitive, ls]	409	432	0.013
LRR [sensitive, ls]	458	481	2.6
LRR [sensitive, ls]	458	481	54
LRR [sensitive, ls]	482	505	0.00042
LRR [sensitive, ls]	482	505	0.0087
LRR [sensitive, ls]	506	526	0.57
LRR [sensitive, ls]	506	526	12
LRR [sensitive, ls]	529	552	0.5
LRR [sensitive, ls]	529	552	10
LRR [sensitive, ls]	554	577	3.5
LRR [sensitive, ls]	554	577	73
LRR [sensitive, ls]	578	601	0.059
LRR [sensitive, ls]	578	601	1.2
LRR [sensitive, ls]	602	625	1
LRR [sensitive, ls]	602	625	22
LRR [sensitive, ls]	626	649	0.0025
LRR [sensitive, ls]	626	649	0.053
LRR [sensitive, ls]	650	675	0.28
LRR [sensitive, ls]	650	675	5.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	2	702	2e-70
FLS2 [A.thaliana]	2	1072	1e-154
CLV2 [A. thaliana]	4	698	1e-66
Xa21 [O. sativa]	18	178	1e-14
Xa21 [O. sativa]	31	204	5e-18
Xa21 [O. sativa]	166	880	1e-160
CLV2 [A. thaliana]	181	666	5e-48
Xa21 [O. sativa]	532	731	9e-20
Pto [L. esculentum]	735	1067	2e-24
Rpg1 [Hordeum vulgare]	761	980	4e-23
Rpg1 [Hordeum vulgare]	761	980	2e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	711	733	out -> in

Report for 2456.m00162

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)