Report for 2456.m00165

 > 2456.m00165, length: 1136, copies: 3 

MALAGKRLLLAAVWPLAWLAAAAAAAAVDVDDGLALTAFMARMSTGSGSPPPPTWGNRSVPVCRWRGVACGARGR

RRGRVVALELPGLGLRGTVPPDLGNLTYLRRLHLAGNRLHGVLPPELGGLAELRHLNLSDNAFQGQIPASLANCT

GLEILALYNNRFHGEIPPELCSLRGLRVLSLGMNTLTGSIPSEIGNLANLMTLNLQFSNLTGGIPEEIGDLAGLV

GLGLGSNQLAGSIPASLGNLSALKYLSIPSAKLTGSIPSLQNLSSLLVLELGENNLEGTVPAWLGNLSSLVFVSL

QQNRLSGHIPESLGRLQMLTSLDLSQNNLISGSIPDSLGNLGALSSLRLDYNKLEGSFPPSLLNLSSLDDLGLQS

NRLSGALPPDIGNKLPNLQRFVVDINQFHGTIPPSLCNATMLQVLQTVYNFLSGRIPQCLGIQQKSLSVVALSKN

QLEATNDADWVFLSSLANCSNLNALDLGYNKLQGELPSSIGNLSSHLSYLIIANNNIEGKIPEGIGNLINLKLLY

MDINRLEGIIPASLGKLKMLNKLSIPYNNLSGSIPPTLGNLTGLNLLQLQGNALNGSIPSNLSSCPLELLDLSYN

SLTGLIPKQLFLISTLSSNMFLGHNFLSGALPAEMGNLKNLGEFDFSSNNISGEIPTSIGECKSLQQLNISGNSL

QGIIPSSLGQLKGLLVLDLSDNNLSGGIPAFLGGMRGLSILNLSYNKFEGEVPRDGVFLNATATFLAGNDDLCGG

IPEMKLPPCFNQTTKKASRKLIIIISICRIMPLITLIFMLFAFYYRNKKAKPNPQISLISEQYTRVSYAELVNAT

NGFASDNLIGAGSFGSVYKGRMTNNDQQVVAVKVLNLTQRGASQSFMAECETLRCVRHRNLVKILTGNEFKAIVY

EYLPNGNLDQWLHPNIMGQSEHKALDLTARLRIAIDVASSLEYLHQYKPSPIIHCDLKPSNVLLDSDMVAHVSDF

GLARFLHQESEKSSGWASMRGTVGYAAPEYGIGNEVSIQGDVYSYGILLLEMFTRKRPTDDEFGEAVGLRKYVQM

ALPDNAANVLDQQLLPETEDGGAIKSNSYNGKDLRITCVTSVMRIGISCSEEAPTDRVQIGDALKELQAIRDKFE

KHVSNEGTSSQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.35
LRR [Pfam ls]	127	150	0.011
LRR [Pfam ls]	151	174	0.57
LRR [Pfam ls]	175	198	7.5
LRR [Pfam ls]	199	222	2.7
LRR [Pfam ls]	247	269	8.9
LRR [Pfam ls]	270	293	0.44
LRR [Pfam ls]	294	317	2.9
LRR [Pfam ls]	318	342	0.25
LRR [Pfam ls]	343	366	1.8
LRR [Pfam ls]	367	391	1.5
LRR [Pfam ls]	471	494	0.068
LRR [Pfam ls]	496	519	0.57
LRR [Pfam ls]	520	543	0.18
LRR [Pfam ls]	544	567	2.6
LRR [Pfam ls]	640	663	8.7
LRR [Pfam fs]	664	687	2.7e-05
LRR [Pfam ls]	664	687	0.00044
LRR [Pfam ls]	688	711	0.024
Ser/Thr pkinase [Pfam fs]	828	1037	5.6e-42
Ser/Thr pkinase [Pfam ls]	828	1080	1.7e-36

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	0.87
LRR [sensitive, ls]	79	102	18
LRR [sensitive, ls]	103	126	0.017
LRR [sensitive, ls]	103	126	0.35
LRR [sensitive, ls]	127	150	0.00052
LRR [sensitive, ls]	127	150	0.011
LRR [sensitive, ls]	151	174	0.027
LRR [sensitive, ls]	151	174	0.57
LRR [sensitive, ls]	175	198	0.36
LRR [sensitive, ls]	175	198	7.5
LRR [sensitive, ls]	199	222	0.13
LRR [sensitive, ls]	199	222	2.7
LRR [sensitive, ls]	223	246	0.53
LRR [sensitive, ls]	223	246	11
LRR [sensitive, ls]	247	269	0.43
LRR [sensitive, ls]	247	269	8.9
LRR [sensitive, ls]	270	293	0.021
LRR [sensitive, ls]	270	293	0.44
LRR [sensitive, ls]	294	317	0.14
LRR [sensitive, ls]	294	317	2.9
LRR [sensitive, ls]	318	342	0.012
LRR [sensitive, ls]	318	342	0.25
LRR [sensitive, ls]	343	366	0.084
LRR [sensitive, ls]	343	366	1.8
LRR [sensitive, ls]	367	391	0.074
LRR [sensitive, ls]	367	391	1.5
LRR [sensitive, ls]	392	415	1.9
LRR [sensitive, ls]	392	415	39
LRR [sensitive, ls]	471	494	0.0033
LRR [sensitive, ls]	471	494	0.068
LRR [sensitive, ls]	496	519	0.028
LRR [sensitive, ls]	496	519	0.57
LRR [sensitive, ls]	520	543	0.0084
LRR [sensitive, ls]	520	543	0.18
LRR [sensitive, ls]	544	567	0.13
LRR [sensitive, ls]	544	567	2.6
LRR [sensitive, ls]	568	588	0.45
LRR [sensitive, ls]	568	588	9.4
LRR [sensitive, ls]	591	614	0.46
LRR [sensitive, ls]	591	614	9.5
LRR [sensitive, ls]	640	663	0.42
LRR [sensitive, ls]	640	663	8.7
LRR [sensitive, ls]	664	687	2.1e-05
LRR [sensitive, ls]	664	687	0.00044
LRR [sensitive, ls]	688	711	0.0012
LRR [sensitive, ls]	688	711	0.024
LRR [sensitive, ls]	712	737	0.68
LRR [sensitive, ls]	712	737	14

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	50	795	1e-73
FLS2 [A.thaliana]	63	1123	1e-172
Xa21 [O. sativa]	63	632	2e-83
CLV2 [A. thaliana]	80	516	2e-40
CLV2 [A. thaliana]	107	758	1e-63
Xa21 [O. sativa]	224	931	1e-163
Pto [L. esculentum]	797	1118	3e-24
Rpg1 [Hordeum vulgare]	821	1031	1e-25
Rpg1 [Hordeum vulgare]	821	1031	3e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	772	794	out -> in

Report for 2456.m00165

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)