Report for 2475.m00100

 > 2475.m00100, length: 997, copies: 2 

MRAHLSQRRMDRSGEPGVGMTSECHMGDTAVVWLVAAVKGERSERMEFIGNHSHKIQLPCQSNLGRKQKTGAFAP

LGFHGRCCRIETSVKCYFLQSLVDSESMISPNLLLLSDEALLTISIVFAYLAGVVPSGHAFPHARNHSQNQHLGA

PGPSDSGRDMKWLPEGNTRFYPSDTWSEVRNVPESSELVDGIKWLQISTTLIDGLIEPTFMKWIQEEKAWENSKI

NEELMKTVTSKIKEDDRILKRFNRLGKSELYLDLLYFLRFGSASYLPNSNPSIRSYSYFDAKFLAEHGARILEDL

VIFLADAVASIYIELISVDGDMPTDVVGSSLALCSLSTRELQRMRNEVAINGWLHQYFESVVSMYEDRFELYVLS

RKLCEKPADNQAEVTNWWRLGFGKPSTVTLLEYVHISSFSLPEERLTLLRFLAELSPPHDNGLAASWRNRTDCCT

WEGIICDVDGAVTKILLASRGLEGRISSSLSELTSLSRLNLSYNSLSGGLPPELIFSGSIVVLDVSFNRLGGELQ

EVDSSSSDWPLQVLNISSNLFTGAFPSTTWEKMSNLVAINASNNSFTGHIPSSFCISSLSFAALDLCYNQFSGEI

PAGIGKCSALRMLKAGHNNISGALPDDLFHATSLEYLSFPNNGLQGTIKLVIKLSNLVFLDLGGNSFSGKVPESI

GELKKLEELRMDHNYISGELPSTLANCTNLAAIVLVSNKFTGDLAKDETIHGLENLQVLGINDCALTGKIPSWLS

KLKKLELLLLYNNQLSGPIPTWIKSLNYLKYVDLSNNSLIGEIPTSLTEMPMLRSDKIADHSNPRLFRMPVFVAP

SLQYHTANAFPKMLNLGNNKFSGVIPMEIGQLKALLSLNLSFNNLHGEIPQSASNLKNLMVLDLSSNHLTGAIPS

SLANLHFLSNFNISYNDLEGPVPTIGQFSTFPTSSFAGNPKLCSPMLLHRCNSAGAAPVSTIPTKQYIDKFVFAI

AFGMFFGVGVLYDQIVVSRFFG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	485	505	2
LRR [Pfam ls]	535	559	7.8
LRR [Pfam ls]	560	583	8.8
LRR [Pfam ls]	656	679	0.14
LRR [Pfam ls]	680	703	0.1
LRR [Pfam ls]	730	753	0.085
LRR [Pfam ls]	754	777	0.082
LRR [Pfam ls]	778	801	2.6
LRR [Pfam ls]	859	882	2.8
LRR [Pfam ls]	883	906	0.031

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	485	505	0.094
LRR [sensitive, ls]	485	505	2
LRR [sensitive, ls]	509	531	1.1
LRR [sensitive, ls]	509	531	22
LRR [sensitive, ls]	535	559	0.38
LRR [sensitive, ls]	535	559	7.8
LRR [sensitive, ls]	560	583	0.43
LRR [sensitive, ls]	560	583	8.8
LRR [sensitive, ls]	585	608	1
LRR [sensitive, ls]	585	608	22
LRR [sensitive, ls]	609	632	0.66
LRR [sensitive, ls]	609	632	14
LRR [sensitive, ls]	633	655	1.1
LRR [sensitive, ls]	633	655	22
LRR [sensitive, ls]	656	679	0.0067
LRR [sensitive, ls]	656	679	0.14
LRR [sensitive, ls]	680	703	0.0049
LRR [sensitive, ls]	680	703	0.1
LRR [sensitive, ls]	730	753	0.0041
LRR [sensitive, ls]	730	753	0.085
LRR [sensitive, ls]	754	777	0.0039
LRR [sensitive, ls]	754	777	0.082
LRR [sensitive, ls]	778	801	0.13
LRR [sensitive, ls]	778	801	2.6
LRR [sensitive, ls]	835	858	1.5
LRR [sensitive, ls]	835	858	31
LRR [sensitive, ls]	859	882	0.14
LRR [sensitive, ls]	859	882	2.8
LRR [sensitive, ls]	883	906	0.0015
LRR [sensitive, ls]	883	906	0.031
LRR [sensitive, ls]	907	932	1.8
LRR [sensitive, ls]	907	932	37

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	417	923	3e-45
Xa21 [O. sativa]	419	939	5e-58
Cf-9 [L. pimpinellifolium]	441	924	9e-39
FLS2 [A.thaliana]	449	939	1e-51
FLS2 [A.thaliana]	461	666	3e-18
Cf-9 [L. pimpinellifolium]	462	794	8e-25
FLS2 [A.thaliana]	462	943	3e-58
Xa21 [O. sativa]	464	943	1e-55
CLV2 [A. thaliana]	465	986	3e-46
Cf-9 [L. pimpinellifolium]	469	942	2e-51
FLS2 [A.thaliana]	524	923	2e-33
Xa21 [O. sativa]	758	983	3e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	971	993	out -> in

Report for 2475.m00100

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)