Report for 2476.m00099

 > 2476.m00099, length: 454, copies: 3 

MLVALFAALVLLCYSAGNIHCVVAVHGNDSDMLALLEFKDAIGDDPAGVLSSWNKTTPFCRWNGVKCGRREHRVT

ALELAGQNLTGRLAAASLGNLSYLHLLDLSGNRFSGQIPRLNSLRKLQVLNLSNNILDGIIPDTLTNCSSLTQLD

LSINLFQGQIPLGIGLLSELSDLVLSRNYLSGHIPSELGKLSKLSSLDLSVNIISGEIPRALYNLSSLRMLFLEM

NFLGKSLPSNIGYALPNLQWLLLGVNMFQGNIPGSLGNISQLHLIYLSENNFSGQIPSSLGKLSNLSVNLQYLLL

DGNNLSGHIPSNMGNLQQLTQLDLSYNNLKGKMPPSLGNLQRLVSFNLSNNNLQGDIPSKFGDLQQLVWLNLGNN

YLHGEVPSSVANLQQLVLLDLSHNNLSGKVPRSLGNLPKLRQLDLSHNNFGGKIPSSLANLRQLSRLDLSYNSLK

GFYA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	98	120	0.29
LRR [Pfam ls]	121	144	0.002
LRR [Pfam ls]	145	168	4.6
LRR [Pfam ls]	169	192	1
LRR [Pfam ls]	193	216	0.93
LRR [Pfam ls]	266	289	0.18
LRR [Pfam ls]	294	317	0.032
LRR [Pfam ls]	318	341	0.004
LRR [Pfam ls]	342	365	0.018
LRR [Pfam ls]	366	389	1.3
LRR [Pfam ls]	390	413	0.0031
LRR [Pfam fs]	414	437	7.6e-05
LRR [Pfam ls]	414	437	0.0013

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	73	97	0.61
LRR [sensitive, ls]	73	97	13
LRR [sensitive, ls]	98	120	0.014
LRR [sensitive, ls]	98	120	0.29
LRR [sensitive, ls]	121	144	9.7e-05
LRR [sensitive, ls]	121	144	0.002
LRR [sensitive, ls]	145	168	0.22
LRR [sensitive, ls]	145	168	4.6
LRR [sensitive, ls]	169	192	0.049
LRR [sensitive, ls]	169	192	1
LRR [sensitive, ls]	193	216	0.045
LRR [sensitive, ls]	193	216	0.93
LRR [sensitive, ls]	217	241	3.8
LRR [sensitive, ls]	217	241	79
LRR [sensitive, ls]	242	265	0.72
LRR [sensitive, ls]	242	265	15
LRR [sensitive, ls]	266	289	0.0085
LRR [sensitive, ls]	266	289	0.18
LRR [sensitive, ls]	294	317	0.0015
LRR [sensitive, ls]	294	317	0.032
LRR [sensitive, ls]	318	341	0.00019
LRR [sensitive, ls]	318	341	0.004
LRR [sensitive, ls]	342	365	0.00086
LRR [sensitive, ls]	342	365	0.018
LRR [sensitive, ls]	366	389	0.064
LRR [sensitive, ls]	366	389	1.3
LRR [sensitive, ls]	390	413	0.00015
LRR [sensitive, ls]	390	413	0.0031
LRR [sensitive, ls]	414	437	6.3e-05
LRR [sensitive, ls]	414	437	0.0013

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	451	6e-63
Xa21 [O. sativa]	1	451	1e-79
Cf-9 [L. pimpinellifolium]	14	256	3e-16
CLV2 [A. thaliana]	31	451	6e-47
Cf-9 [L. pimpinellifolium]	52	451	6e-41
CLV2 [A. thaliana]	73	439	2e-41
Xa21 [O. sativa]	73	432	3e-51
CLV2 [A. thaliana]	74	451	2e-45
FLS2 [A.thaliana]	74	451	2e-52
Xa21 [O. sativa]	74	451	4e-53
CLV2 [A. thaliana]	76	384	2e-24
Cf-9 [L. pimpinellifolium]	77	430	1e-40
FLS2 [A.thaliana]	77	451	8e-55
FLS2 [A.thaliana]	77	451	3e-50
FLS2 [A.thaliana]	84	432	2e-53
CLV2 [A. thaliana]	94	452	2e-42
FLS2 [A.thaliana]	95	335	1e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2476.m00099

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)