Report for 2476.m00102

 > 2476.m00102, length: 564, copies: 3 

MAAFLAFLLLLLLSYGAGSIRCEATLNNTADLLSLMDFKKHITEDPTQAMSSWNASVPFCQWTGVSCSRRHPGRV

TALNLFKLSLSGTISSSLGNLTFLKALNFSSNHFSGKLPPLNHLHRLKVLDLRHNSLRDTIPEGLANCSRLRVLD

LSSNSLVGEIPTKLGLLTNLSSLCLSNNSFTGTIPPTLGNITGLNYLSLQINHLEGSIPRELGKLSDLLSLNIFM

NNISGRLPHELFNLSSLQTLWLSDNMLGKEALPPNIGDVLPNLQFLSLARNMFEGHIPTSLINASGLWLIDLTNN

NFYGQVPSYLSELANLSDLYLAGNHLEASDNEKWLHAFANCTLLQALNLARNQIKGDIPSSIGNLSTNLQYLNLG

VNHFVGVVPPSIGNLHGLTSLWLSKNNLIGTIEEWVGKLRNLELLYLQENNFTGSIPSSIGDLTNLIQFSLGKNS

LDGQIPANLGNLRQLDRLNFSYNNLHGSIPYNVGKLRNLVQLDLSHNNLDGNIPSSFIKLQKLKHLDLSDNNFQG

IGLICTGKINNPRRGVSIAKAQHNVSYGCSRIVNVSPKS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	98	120	1.1
LRR [Pfam ls]	121	144	0.0078
LRR [Pfam ls]	145	168	0.041
LRR [Pfam ls]	169	192	0.069
LRR [Pfam ls]	193	216	3.4
LRR [Pfam ls]	241	266	0.17
LRR [Pfam ls]	267	290	7.5
LRR [Pfam ls]	343	366	0.54
LRR [Pfam ls]	368	391	1.3
LRR [Pfam ls]	392	415	4.5
LRR [Pfam ls]	416	439	0.0087
LRR [Pfam ls]	464	487	1.9
LRR [Pfam ls]	488	511	0.019
LRR [Pfam ls]	512	533	0.72

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	74	97	1.7
LRR [sensitive, ls]	74	97	36
LRR [sensitive, ls]	98	120	0.055
LRR [sensitive, ls]	98	120	1.1
LRR [sensitive, ls]	121	144	0.00037
LRR [sensitive, ls]	121	144	0.0078
LRR [sensitive, ls]	145	168	0.002
LRR [sensitive, ls]	145	168	0.041
LRR [sensitive, ls]	169	192	0.0033
LRR [sensitive, ls]	169	192	0.069
LRR [sensitive, ls]	193	216	0.16
LRR [sensitive, ls]	193	216	3.4
LRR [sensitive, ls]	217	240	3
LRR [sensitive, ls]	217	240	63
LRR [sensitive, ls]	241	266	0.008
LRR [sensitive, ls]	241	266	0.17
LRR [sensitive, ls]	267	290	0.36
LRR [sensitive, ls]	267	290	7.5
LRR [sensitive, ls]	291	314	1.6
LRR [sensitive, ls]	291	314	33
LRR [sensitive, ls]	315	339	1.6
LRR [sensitive, ls]	315	339	33
LRR [sensitive, ls]	343	366	0.026
LRR [sensitive, ls]	343	366	0.54
LRR [sensitive, ls]	368	391	0.061
LRR [sensitive, ls]	368	391	1.3
LRR [sensitive, ls]	392	415	0.21
LRR [sensitive, ls]	392	415	4.5
LRR [sensitive, ls]	416	439	0.00042
LRR [sensitive, ls]	416	439	0.0087
LRR [sensitive, ls]	440	463	0.91
LRR [sensitive, ls]	440	463	19
LRR [sensitive, ls]	464	487	0.091
LRR [sensitive, ls]	464	487	1.9
LRR [sensitive, ls]	488	511	0.00091
LRR [sensitive, ls]	488	511	0.019
LRR [sensitive, ls]	512	533	0.035
LRR [sensitive, ls]	512	533	0.72

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	523	4e-51
FLS2 [A.thaliana]	7	525	1e-67
Xa21 [O. sativa]	31	525	2e-87
Cf-9 [L. pimpinellifolium]	33	543	2e-49
Xa21 [O. sativa]	73	514	4e-53
CLV2 [A. thaliana]	75	526	2e-39
FLS2 [A.thaliana]	75	434	3e-39
Cf-9 [L. pimpinellifolium]	78	519	4e-41
CLV2 [A. thaliana]	78	388	7e-29
FLS2 [A.thaliana]	78	525	1e-69
FLS2 [A.thaliana]	78	525	2e-59
CLV2 [A. thaliana]	84	553	2e-42
FLS2 [A.thaliana]	85	525	2e-60
Cf-9 [L. pimpinellifolium]	99	504	2e-42
Xa21 [O. sativa]	337	539	1e-23
FLS2 [A.thaliana]	344	536	8e-14
N [N. glutinosa]	357	520	2e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2476.m00102

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)