Report for 2481.m00051

 > 2481.m00051, length: 1208, copies: 1 

MNALVILLCSTLLLYSPAAVCTVGSSSSSTNATDKQAAALLSFRSMVSDPSGALTWWNASNHPCRWRGVACGRGR

HAGSVVALSLGSSSLSGLISPFLGNLSFLRVLDLGANQLVGQIPPELGRLGRLRELNLSGNSLEGGIPPALAIGC

SKLESLSLDSNHLRGEIPGEIAALRNLAYLNLRANNLSGEIPPSLGNLSSLYFLNLGFNMLFGEIPASLGNLSQL

NALGIQHNQLSGGIPSSLGHLNNLTSLLLQANGLIGSIPPNICNISFLKHFSVENNELSGMLPPNVFNTLPMLET

FDAGENMFDGHIPSSLVNASKLSRFQIAENHFSGVIPPELGGLQGLKWFILTENDLEAKESNDWKFMKALTNCSQ

LEVLELEANKFSGTLPSVISNLSASLTILTLASNKIVGNMPREIGKLINLGALVAHNNFLTGSPPSSLGMLQNLR

ILWLDNNYFSGPFPRVICNLTHMDSLDLGRNNFSGSIPITVGNMVSLSSLRFSFNNFIGTIPTSLFNITTLSIYL

DISYNHLDGSIPPEVGNLPNLVYLDARYNQLSGEIPITFEKCQLLQILYLQNNSFIGNIPSSFSEMKGLEILDLS

SNNFSGQIPKFFGHFLTLYDLNLSYNNFDGEVPVFGVFANATGISVQGNNKLCGGIPDLHLPTCSLKISKRRHRV

PGLAIVVPLVATTICILSLLLFFHAWYKNRLTKSPSTMSMRAHQLVSYQQLVHATDGFSTTNLLGTGSYGSVYRG

KLFDETGENENLIAVKVLKLQTPGALKSFTAECEAMKNLRHRNLVKIVTACSSMDFNGNDFKAIVFDFMPNGCLE

EWLHPQIDNQLEERHLNLVHRVGILFDVACALDYLHFHGTTPVVHCDLKPSNVLLDADMVAHVGDFGLAKILSSQ

PSTSSMGFRGTIGYAPPEYGAGNMVSTHGDIYSYGILVLEMITGRRPTDNTCEQGFSLRKCVEMALNNRAMDILD

VELVTELENAPPATSMDGPSERVNSLISLLKLGLLCSGEMPLSRMSTKDIIKELLADTKLSVRPKTSQPQEREES

RRKKAGEAEARAHGGGEEGFMEPEKSKEAASQPMEADAGGPVDPRELVSSDDEIDYSVEPEFYDPDLDDVDERHE

TYVNQYRAMFVRNCKVKTDQILREGKGKRKNRKGKAADSSTTSEGEKKGAVYHPVCCEVCSTEVGVFDEDEVYHF

FNVIPSNS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.81
LRR [Pfam ls]	127	151	0.014
LRR [Pfam ls]	152	175	0.2
LRR [Pfam ls]	176	199	0.014
LRR [Pfam ls]	200	223	2.6
LRR [Pfam ls]	224	247	1.7
LRR [Pfam ls]	248	271	6
LRR [Pfam ls]	272	296	0.59
LRR [Pfam ls]	375	398	0.16
LRR [Pfam ls]	448	471	0.22
LRR [Pfam ls]	545	568	0.88
LRR [Pfam ls]	569	592	0.75
LRR [Pfam ls]	593	616	0.11
LRR [Pfam ls]	617	639	7.4
Ser/Thr pkinase [Pfam fs]	733	950	1e-48
Ser/Thr pkinase [Pfam ls]	733	1031	5.1e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	0.93
LRR [sensitive, ls]	79	102	19
LRR [sensitive, ls]	103	126	0.039
LRR [sensitive, ls]	103	126	0.81
LRR [sensitive, ls]	127	151	0.00067
LRR [sensitive, ls]	127	151	0.014
LRR [sensitive, ls]	152	175	0.0096
LRR [sensitive, ls]	152	175	0.2
LRR [sensitive, ls]	176	199	0.00069
LRR [sensitive, ls]	176	199	0.014
LRR [sensitive, ls]	200	223	0.13
LRR [sensitive, ls]	200	223	2.6
LRR [sensitive, ls]	224	247	0.083
LRR [sensitive, ls]	224	247	1.7
LRR [sensitive, ls]	248	271	0.29
LRR [sensitive, ls]	248	271	6
LRR [sensitive, ls]	272	296	0.028
LRR [sensitive, ls]	272	296	0.59
LRR [sensitive, ls]	321	344	0.63
LRR [sensitive, ls]	321	344	13
LRR [sensitive, ls]	345	368	5.9
LRR [sensitive, ls]	345	368	120
LRR [sensitive, ls]	375	398	0.0076
LRR [sensitive, ls]	375	398	0.16
LRR [sensitive, ls]	400	423	0.9
LRR [sensitive, ls]	400	423	19
LRR [sensitive, ls]	424	447	1.2
LRR [sensitive, ls]	424	447	25
LRR [sensitive, ls]	448	471	0.011
LRR [sensitive, ls]	448	471	0.22
LRR [sensitive, ls]	472	495	0.53
LRR [sensitive, ls]	472	495	11
LRR [sensitive, ls]	496	520	0.71
LRR [sensitive, ls]	496	520	15
LRR [sensitive, ls]	521	544	0.85
LRR [sensitive, ls]	521	544	18
LRR [sensitive, ls]	545	568	0.042
LRR [sensitive, ls]	545	568	0.88
LRR [sensitive, ls]	569	592	0.036
LRR [sensitive, ls]	569	592	0.75
LRR [sensitive, ls]	593	616	0.0052
LRR [sensitive, ls]	593	616	0.11
LRR [sensitive, ls]	617	639	0.36
LRR [sensitive, ls]	617	639	7.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	4	847	0
Cf-9 [L. pimpinellifolium]	12	757	8e-51
FLS2 [A.thaliana]	34	657	3e-92
CLV2 [A. thaliana]	38	608	1e-57
Cf-9 [L. pimpinellifolium]	82	443	3e-28
Cf-9 [L. pimpinellifolium]	83	662	4e-53
FLS2 [A.thaliana]	83	1030	1e-130
CLV2 [A. thaliana]	152	609	1e-49
CLV2 [A. thaliana]	211	657	2e-43
Pto [L. esculentum]	704	945	5e-21
Rpg1 [Hordeum vulgare]	722	950	3e-24
Rpg1 [Hordeum vulgare]	730	1029	2e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	503	525	out -> in
putative TM domain	677	699	in -> out

Report for 2481.m00051

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)