Report for 2482.m00167

 > 2482.m00167, length: 1044, copies: 2 

MACAALVAVAAILFFSTLTALADEREALLCLKSHLSSPNGSAFSTWSNTISPDFCTWRGVTCSIKLQERPRVVVA

LDMEAGGLTGEIPPCISNLSSLARIHLPNNGLSGGLTFTADVARLQYLNLSFNAISGEIPRGLGTLPNLSSLDLT

SNNLHGRIPPLLGSSSALESVGLADNYLTGEIPLFLANASSLRYLSLKNNSLYGSIPAALFNSSTIREIYLRKNN

LSGAIPPVTMFTSRITNLDLTTNSLSGGIPPSLANLSSLTAFLAAQNQLQGSIPDFSKLSALQYLDLSYNNLSGA

VNPSIYNMSSISFLGLANNNLEGMMPPDIGNTLPNIQVLMMSNNHFVGEIPKSLANASNMQFLYLANNSLRGVIP

SFSLMTDLQVVMLYSNQLEAGDWAFLSSLKNCSNLLKLHFGENNLRGDMPSSVADLPKTLTSLALPSNYISGTIP

LEIGNLSSMSLLYLDNNLLTGSIPHTLGQLNNLVVLSLSQNKFSGEIPQSIGNLNQLAELYLSENQLSGRIPTTL

ARCQQLLALNLSSNALTGSISGDMFVKLNQLSWLLDLSHNQFISSIPLKFGSLINLASLNISHNRLTGRIPSTLG

SCVRLESLRVAGNLLEGSIPQSLANLRGTKVLDFSANNLSGAIPDFFGTFTSLQYLNMSYNNFEGPIPVGGIFSD

RDKVFVQGNPHLCTNVPMDELTVCSASASKRKHKLVIPMLAVFSSIVLLSSILGLYLLIVNVFLKRKGKSNEHID

HSYMELKKLTYSDVSKATNNFSAANIVGSGHFGTVYRGILDTEDTMVAVKVFKLDQCGALDSFMAECKALKNIRH

RNLVKVITACSTYDPMGSEFKALVFEYMANGSLESRLHTRFDPCGDLSLGERISIAFDIASALEYLHNQCIPPVV

HCDLKPSNVLFNHDYVACVCDFGLARSIREYSSGTQSISRSMAGPRGSIGYIAPEYGMGSQISTEGDVYSYGIIL

LEMLTGRHPTNEIFTDGFTLRMYVNASLSQIKDILDPRLIPEMTEQPSNHTLQLHEHKTALPNLSSEVS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	142	0.0056
LRR [Pfam ls]	143	166	0.55
LRR [Pfam ls]	191	214	1.4
LRR [Pfam ls]	239	262	0.18
LRR [Pfam ls]	286	309	0.32
LRR [Pfam ls]	310	334	7.1
LRR [Pfam ls]	335	358	1.8
LRR [Pfam ls]	359	381	0.13
LRR [Pfam ls]	409	432	7.9
LRR [Pfam ls]	434	457	8.1
LRR [Pfam ls]	458	481	2
LRR [Pfam ls]	482	505	0.045
LRR [Pfam ls]	506	529	2.3
LRR [Pfam ls]	530	554	0.38
LRR [Pfam ls]	580	603	0.082
LRR [Pfam ls]	604	627	0.27
LRR [Pfam ls]	628	651	2.8
LRR [Pfam ls]	652	673	5
Ser/Thr pkinase [Pfam fs]	771	985	2.2e-55
Ser/Thr pkinase [Pfam ls]	771	1035	6.8e-50

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	119	142	0.00027
LRR [sensitive, ls]	119	142	0.0056
LRR [sensitive, ls]	143	166	0.027
LRR [sensitive, ls]	143	166	0.55
LRR [sensitive, ls]	167	190	1.3
LRR [sensitive, ls]	167	190	27
LRR [sensitive, ls]	191	214	0.069
LRR [sensitive, ls]	191	214	1.4
LRR [sensitive, ls]	215	237	0.54
LRR [sensitive, ls]	215	237	11
LRR [sensitive, ls]	239	262	0.0086
LRR [sensitive, ls]	239	262	0.18
LRR [sensitive, ls]	263	285	0.91
LRR [sensitive, ls]	263	285	19
LRR [sensitive, ls]	286	309	0.016
LRR [sensitive, ls]	286	309	0.32
LRR [sensitive, ls]	310	334	0.34
LRR [sensitive, ls]	310	334	7.1
LRR [sensitive, ls]	335	358	0.085
LRR [sensitive, ls]	335	358	1.8
LRR [sensitive, ls]	359	381	0.0064
LRR [sensitive, ls]	359	381	0.13
LRR [sensitive, ls]	382	408	2.4
LRR [sensitive, ls]	382	408	50
LRR [sensitive, ls]	409	432	0.38
LRR [sensitive, ls]	409	432	7.9
LRR [sensitive, ls]	434	457	0.39
LRR [sensitive, ls]	434	457	8.1
LRR [sensitive, ls]	458	481	0.098
LRR [sensitive, ls]	458	481	2
LRR [sensitive, ls]	482	505	0.0022
LRR [sensitive, ls]	482	505	0.045
LRR [sensitive, ls]	506	529	0.11
LRR [sensitive, ls]	506	529	2.3
LRR [sensitive, ls]	530	554	0.018
LRR [sensitive, ls]	530	554	0.38
LRR [sensitive, ls]	556	579	3.9
LRR [sensitive, ls]	556	579	80
LRR [sensitive, ls]	580	603	0.0039
LRR [sensitive, ls]	580	603	0.082
LRR [sensitive, ls]	604	627	0.013
LRR [sensitive, ls]	604	627	0.27
LRR [sensitive, ls]	628	651	0.14
LRR [sensitive, ls]	628	651	2.8
LRR [sensitive, ls]	652	673	0.24
LRR [sensitive, ls]	652	673	5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	6	668	3e-84
Cf-9 [L. pimpinellifolium]	45	668	2e-52
CLV2 [A. thaliana]	56	745	5e-62
Cf-9 [L. pimpinellifolium]	71	372	3e-24
FLS2 [A.thaliana]	71	500	5e-54
FLS2 [A.thaliana]	73	1003	1e-140
Cf-9 [L. pimpinellifolium]	76	687	7e-60
Xa21 [O. sativa]	147	879	1e-144
CLV2 [A. thaliana]	237	779	8e-49
FLS2 [A.thaliana]	536	694	1e-11
Pto [L. esculentum]	755	1008	5e-27
Rpg1 [Hordeum vulgare]	757	982	6e-27
Rpg1 [Hordeum vulgare]	758	998	7e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	22	in -> out
putative TM domain	717	739	out -> in

Report for 2482.m00167

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)