Report for 2493.m00128

 > 2493.m00128, length: 1131, copies: 1 

MIRLFAPCPKFIPLLAVFIISCSLPLAISDDTDTDREALLCFKSQISDPNGSLSSWSNTSQNFCNWQGVSCNNTQ

TQLRVMALNVSSKGLSGSIPPCIANLSSITSLDLSRNAFLGKIPSELGRLRQISYLNLSINSLEGRIPDELSSCS

NLKVLGLSNNSLQGEIPQSLTQCTHLQQVILYNNKLEGSIPTGFGTLPELKTLDLSSNALRGDIPPLLGSSPSFV

YVNLGGNQLTGGIPEFLANSSSLQVLRLTQNSLTGEIPPALFNSSTLRTIYLDRNNLVGSIPPVTAIAAPIQYLT

LEQNKLTGGIPASLGNLSSLVHVSLKANNLVGSIPESLSKIPTLERLVLTYNNLSGHVPQAIFNISSLKYLSMAN

NSLIGQLPPDIGNRLPNLEALILSTTQLNGPIPASLRNMSKLEMVYLAAAGLTGIVPSFGSLPNLQDLDLGYNQL

EAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQLNWLWLRQNRLSGAIPSEIGNLKSLSVLYLDENM

FSGSIPPTIGNLSNLLVLSLAQNNLSGLIPDSIGNLAQLTEFHLDGNNFNGSIPSNLGQWRQLEKLDLSHNSFGE

SLPSEVFNISSLSQSLDLSHNLFTGPIPLEIGNLINLGSISISNNRLTGEIPSTLGNCVLLEYLHMEGNLLTGSI

PQSFMNLKSIKELDLSRNSLSGKVPEFLTLLSSLQKLNLSFNDFEGPIPSNGVFGNASRAILDGNYRLCVNDPGY

SLPLCRESGSQSKHKSTILKIVIPIAVSVVILLLCLMAVLIKRRKQKPSLQQSSVNMRKISYEDIANATDGFSPT

NLVGLGSFGAVYKGMLPFETNPVAIKVFDLNKYGAPTSFNAECEALRYIRHRNLVKIITLCSTIDPNGYDFKALV

FQYMPNGSLEMWLHPEDHGHGKKRFLTLGERISLALDIAYALDYLHNQCVSPLIHCDIKPSNVLLDLEMTAYVSD

FGLARFMGANSTAAPGNSTSLADLKGSIGYIAPEYGMGGQISTKGDVYSYGVLLLEILTGKRPTDEKFNDGLSLH

DRVDAAFPHRVTEILDPNMLHNDLDGGNSELMQSCVLPLVKVALMCSMASPKDRLGMAQVSTELQSIKQAFLELS

SGGKVV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.2
LRR [Pfam ls]	127	150	2.7
LRR [Pfam ls]	151	174	0.036
LRR [Pfam ls]	175	198	0.082
LRR [Pfam ls]	199	222	0.033
LRR [Pfam ls]	223	246	4.8
LRR [Pfam ls]	247	270	0.073
LRR [Pfam ls]	271	293	8
LRR [Pfam ls]	295	318	3.7
LRR [Pfam ls]	343	366	6.2
LRR [Pfam ls]	367	391	0.49
LRR [Pfam ls]	392	415	8.1
LRR [Pfam ls]	439	465	3.1
LRR [Pfam ls]	466	489	7
LRR [Pfam ls]	491	514	0.89
LRR [Pfam ls]	515	538	0.16
LRR [Pfam ls]	539	562	0.028
LRR [Pfam ls]	563	586	1.9
LRR [Pfam ls]	587	611	0.1
LRR [Pfam ls]	636	659	0.56
LRR [Pfam ls]	660	683	0.072
LRR [Pfam ls]	684	707	0.22
LRR [Pfam ls]	708	733	5.8
Ser/Thr pkinase [Pfam fs]	822	1041	7.4e-44
Ser/Thr pkinase [Pfam ls]	822	1082	2.2e-38

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	126	0.0097
LRR [sensitive, ls]	103	126	0.2
LRR [sensitive, ls]	127	150	0.13
LRR [sensitive, ls]	127	150	2.7
LRR [sensitive, ls]	151	174	0.0017
LRR [sensitive, ls]	151	174	0.036
LRR [sensitive, ls]	175	198	0.004
LRR [sensitive, ls]	175	198	0.082
LRR [sensitive, ls]	199	222	0.0016
LRR [sensitive, ls]	199	222	0.033
LRR [sensitive, ls]	223	246	0.23
LRR [sensitive, ls]	223	246	4.8
LRR [sensitive, ls]	247	270	0.0035
LRR [sensitive, ls]	247	270	0.073
LRR [sensitive, ls]	271	293	0.39
LRR [sensitive, ls]	271	293	8
LRR [sensitive, ls]	295	318	0.18
LRR [sensitive, ls]	295	318	3.7
LRR [sensitive, ls]	319	342	0.58
LRR [sensitive, ls]	319	342	12
LRR [sensitive, ls]	343	366	0.3
LRR [sensitive, ls]	343	366	6.2
LRR [sensitive, ls]	367	391	0.024
LRR [sensitive, ls]	367	391	0.49
LRR [sensitive, ls]	392	415	0.39
LRR [sensitive, ls]	392	415	8.1
LRR [sensitive, ls]	416	438	0.66
LRR [sensitive, ls]	416	438	14
LRR [sensitive, ls]	439	465	0.15
LRR [sensitive, ls]	439	465	3.1
LRR [sensitive, ls]	466	489	0.34
LRR [sensitive, ls]	466	489	7
LRR [sensitive, ls]	491	514	0.043
LRR [sensitive, ls]	491	514	0.89
LRR [sensitive, ls]	515	538	0.0076
LRR [sensitive, ls]	515	538	0.16
LRR [sensitive, ls]	539	562	0.0014
LRR [sensitive, ls]	539	562	0.028
LRR [sensitive, ls]	563	586	0.091
LRR [sensitive, ls]	563	586	1.9
LRR [sensitive, ls]	587	611	0.005
LRR [sensitive, ls]	587	611	0.1
LRR [sensitive, ls]	612	635	2.3
LRR [sensitive, ls]	612	635	48
LRR [sensitive, ls]	636	659	0.027
LRR [sensitive, ls]	636	659	0.56
LRR [sensitive, ls]	660	683	0.0035
LRR [sensitive, ls]	660	683	0.072
LRR [sensitive, ls]	684	707	0.01
LRR [sensitive, ls]	684	707	0.22
LRR [sensitive, ls]	708	733	0.28
LRR [sensitive, ls]	708	733	5.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	14	604	2e-79
CLV2 [A. thaliana]	17	749	3e-75
FLS2 [A.thaliana]	37	1118	1e-163
Cf-9 [L. pimpinellifolium]	55	740	2e-71
Xa21 [O. sativa]	64	336	2e-27
Cf-9 [L. pimpinellifolium]	78	284	1e-15
Xa21 [O. sativa]	225	933	1e-153
Xa21 [O. sativa]	489	817	3e-29
Rpg1 [Hordeum vulgare]	740	1117	8e-27
Pto [L. esculentum]	803	1115	8e-25
Rpg1 [Hordeum vulgare]	819	1036	4e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	772	791	out -> in

Report for 2493.m00128

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)