Report for 2493.m00131

 > 2493.m00131, length: 1044, copies: 1 

MIRLFASCPKLIPLLAVFIFSSSLPLAISDDTDTDREALLCFKSQISDPNGALSSWTNTSLNFCSWQGVSCNSTQ

PQLRVMALNVSSKGLGGLIPPCIGNLSSIASLDLSNNAFLGKIPSELGRLGQISYLNLSINSLEGRIPDELTSCR

NLQVLGLWNNSLQGEIPPSLTQCTHLQQVMLSNNKLEGEIPTGFGTLRELKTLDLSNNALTGDIPPLLGSSPSFI

YVDLGVNQLTGGIPEFLANSSSLQVIRLMQNGLTGEIPPSLFNSSKLTTIYLNRNNLVGSIPPITAVAAPIQYLS

LAQNKLTGGIPASLGNLSSMVLLSLGANSLVGSIPESLSKIQTLERLVLTYNKLSGNVPQNIFNMTSLKYLGMAN

NSLIGRLPPDIGNRLPNLETLILSTTQLNGPIPASLANMSKLEMIYLTATGLTGVVPSFGSLPNLQDLDLAYNQL

EAGDWSFLSSLANCTQLKKLALDGNILRGSLPSSVGNLPSQLNWLFLKQNKLSGTIPSEIGNLKSLTVMYMDNNM

FSGSIPPTIGNLSNLLVLSFAQNNLSGHIPDSIGSLSQLTEFYIDGNNLNGSIPANIGQWRQLEKLDLSHNFFGG

SLPSEVFNISSLSKSLDLSHNLFTGPIPLEIGNLINLGSISISNNRLNGEIPSTLGKCVLLEYLHMEGNLLTGSI

PQSFMNLKSIKELDLSRNSLSGKVPEFLTLLSSLQKLNLSFNDFEGAIPSNGVFGNASRVILGGNYRLCANAPGY

GLPFCPESGSQSKSKSTVLKIVIPIVVSAVVISLLCLTVVLMKRRKEEPNLQHSSVNLRKISYEDIAKATDGFSA

TNLVGLGSFGAVYKGLLAFEDNPVAIKIFNLNKYGAPTSFNAECEALRYIRHRNLVKIITLCSTVDPNGYDFKAL

VFQYMPNGSLEMWLHPEDHGLEYGMGGQISTKGDVYSYGVLLLEILTGKRPTDEKFNDGLSLHDRVDAALPHRVT

EVLDPNMLHNDLDGGNSELMQSCVLPLVKVALMCSIASPKDRLGMAQVSTEINSIKQAFVDLSSGGKMV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.81
LRR [Pfam ls]	127	150	5.8
LRR [Pfam ls]	151	174	0.083
LRR [Pfam ls]	175	198	0.21
LRR [Pfam ls]	199	222	0.0034
LRR [Pfam ls]	247	270	6.9
LRR [Pfam ls]	271	293	3.2
LRR [Pfam ls]	295	318	2.2
LRR [Pfam ls]	343	366	3.2
LRR [Pfam ls]	367	391	2.1
LRR [Pfam ls]	392	415	3.8
LRR [Pfam ls]	416	438	7.6
LRR [Pfam ls]	439	465	3.6
LRR [Pfam ls]	466	489	2
LRR [Pfam ls]	491	514	0.71
LRR [Pfam ls]	515	538	0.59
LRR [Pfam ls]	539	562	1.9
LRR [Pfam ls]	563	586	5.5
LRR [Pfam ls]	587	611	0.074
LRR [Pfam ls]	636	659	5.8
LRR [Pfam ls]	660	683	0.072
LRR [Pfam ls]	684	707	0.22
LRR [Pfam ls]	708	732	3.1
Ser/Thr pkinase [Pfam fs]	823	910	1.3e-09
Ser/Thr pkinase [Pfam ls]	823	1023	1.6e-06
Ser/Thr pkinase [Pfam fs]	925	954	0.0006

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	126	0.039
LRR [sensitive, ls]	103	126	0.81
LRR [sensitive, ls]	127	150	0.28
LRR [sensitive, ls]	127	150	5.8
LRR [sensitive, ls]	151	174	0.004
LRR [sensitive, ls]	151	174	0.083
LRR [sensitive, ls]	175	198	0.0099
LRR [sensitive, ls]	175	198	0.21
LRR [sensitive, ls]	199	222	0.00016
LRR [sensitive, ls]	199	222	0.0034
LRR [sensitive, ls]	223	246	1.9
LRR [sensitive, ls]	223	246	39
LRR [sensitive, ls]	247	270	0.33
LRR [sensitive, ls]	247	270	6.9
LRR [sensitive, ls]	271	293	0.16
LRR [sensitive, ls]	271	293	3.2
LRR [sensitive, ls]	295	318	0.11
LRR [sensitive, ls]	295	318	2.2
LRR [sensitive, ls]	319	342	1.3
LRR [sensitive, ls]	319	342	27
LRR [sensitive, ls]	343	366	0.15
LRR [sensitive, ls]	343	366	3.2
LRR [sensitive, ls]	367	391	0.1
LRR [sensitive, ls]	367	391	2.1
LRR [sensitive, ls]	392	415	0.18
LRR [sensitive, ls]	392	415	3.8
LRR [sensitive, ls]	416	438	0.37
LRR [sensitive, ls]	416	438	7.6
LRR [sensitive, ls]	439	465	0.17
LRR [sensitive, ls]	439	465	3.6
LRR [sensitive, ls]	466	489	0.095
LRR [sensitive, ls]	466	489	2
LRR [sensitive, ls]	491	514	0.034
LRR [sensitive, ls]	491	514	0.71
LRR [sensitive, ls]	515	538	0.028
LRR [sensitive, ls]	515	538	0.59
LRR [sensitive, ls]	539	562	0.091
LRR [sensitive, ls]	539	562	1.9
LRR [sensitive, ls]	563	586	0.27
LRR [sensitive, ls]	563	586	5.5
LRR [sensitive, ls]	587	611	0.0036
LRR [sensitive, ls]	587	611	0.074
LRR [sensitive, ls]	612	635	3
LRR [sensitive, ls]	612	635	62
LRR [sensitive, ls]	636	659	0.28
LRR [sensitive, ls]	636	659	5.8
LRR [sensitive, ls]	660	683	0.0035
LRR [sensitive, ls]	660	683	0.072
LRR [sensitive, ls]	684	707	0.01
LRR [sensitive, ls]	684	707	0.22
LRR [sensitive, ls]	708	732	0.15
LRR [sensitive, ls]	708	732	3.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	8	740	1e-71
FLS2 [A.thaliana]	11	915	1e-132
Xa21 [O. sativa]	12	604	2e-84
CLV2 [A. thaliana]	17	749	2e-68
Cf-9 [L. pimpinellifolium]	77	284	1e-12
Xa21 [O. sativa]	83	311	9e-23
Xa21 [O. sativa]	91	336	1e-25
Xa21 [O. sativa]	232	917	1e-151
Xa21 [O. sativa]	489	714	8e-27
Xa21 [O. sativa]	616	735	1e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	772	791	out -> in

Report for 2493.m00131

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)