Report for 2493.m00134

 > 2493.m00134, length: 675, copies: 1 

MIRLFASFPKLIPLLAVFIFSCSLPIAISDDTDTDRGALLCFKSQISDPNGALRSWSNTSLDFCNWQGVSCNNTQ

TQIRVMGLNISSKGLSGSIPPCIGNLSSIASLDLSNNAFLGKIPAELGHLGQISYLNLSINSLEGHIPDELSLCS

KLKVLSLCNNSLQGEIPPSLTQCTHLQQVVLCNNKLQGRIPTKFGMLHELKTLDLSNNALTGDIPPLLGSSPSFV

YVDLGGNQLTGGIPEFLANSSSLQVLSLKQNNLTGGIPLALFNSSTLTTIYLNRNNLVGSIPPVTAIAAPLQFLS

LALNKLRGGIPASLGNLSSLVRLSLAVNNLVGSIPGSLSELRKLERLILTYNNLSGPVPQSIFNMSSLQYLEMAN

NSLISQLPPDIGNRLPNLQSLILSMTHLSGPIPASLANMSKLEMIYLVATGLTGVVPSFGLLPNLRDLDLAYNHL

EAGDWSFLSSLANCTQLKKLCLDGNSLEGSLPSSVGNLAPQLEWLWLKQNKIYGTIPSEIGNLRSLTILYMDNNL

FSGHIPPSIGNLSNLQALSFALNDLFGQIPDSIGNLAQLIEFHIDGNNFSGSIPSSLWHWKHLEKLDISDNSFFG

YIPPAVGNLSSIRDLIFARNNFFGHIPSTVGNLSNLSILSFAQNNLFGHIPEFVGNLVKLTNLFLHGNSFSGSIP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.38
LRR [Pfam ls]	127	150	4
LRR [Pfam ls]	151	174	0.047
LRR [Pfam ls]	199	222	0.0034
LRR [Pfam ls]	223	246	3.3
LRR [Pfam ls]	247	270	1.1
LRR [Pfam ls]	271	293	8.7
LRR [Pfam ls]	319	342	6.1
LRR [Pfam ls]	343	366	0.21
LRR [Pfam ls]	367	391	0.09
LRR [Pfam ls]	392	415	8.6
LRR [Pfam ls]	439	465	3.2
LRR [Pfam ls]	466	489	1.4
LRR [Pfam ls]	491	514	2.1
LRR [Pfam ls]	515	538	0.057
LRR [Pfam ls]	563	586	6.3
LRR [Pfam ls]	587	610	0.1

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	126	0.018
LRR [sensitive, ls]	103	126	0.38
LRR [sensitive, ls]	127	150	0.19
LRR [sensitive, ls]	127	150	4
LRR [sensitive, ls]	151	174	0.0023
LRR [sensitive, ls]	151	174	0.047
LRR [sensitive, ls]	175	198	0.65
LRR [sensitive, ls]	175	198	14
LRR [sensitive, ls]	199	222	0.00016
LRR [sensitive, ls]	199	222	0.0034
LRR [sensitive, ls]	223	246	0.16
LRR [sensitive, ls]	223	246	3.3
LRR [sensitive, ls]	247	270	0.051
LRR [sensitive, ls]	247	270	1.1
LRR [sensitive, ls]	271	293	0.42
LRR [sensitive, ls]	271	293	8.7
LRR [sensitive, ls]	295	318	0.85
LRR [sensitive, ls]	295	318	18
LRR [sensitive, ls]	319	342	0.29
LRR [sensitive, ls]	319	342	6.1
LRR [sensitive, ls]	343	366	0.01
LRR [sensitive, ls]	343	366	0.21
LRR [sensitive, ls]	367	391	0.0043
LRR [sensitive, ls]	367	391	0.09
LRR [sensitive, ls]	392	415	0.42
LRR [sensitive, ls]	392	415	8.6
LRR [sensitive, ls]	416	438	1.2
LRR [sensitive, ls]	416	438	25
LRR [sensitive, ls]	439	465	0.16
LRR [sensitive, ls]	439	465	3.2
LRR [sensitive, ls]	466	489	0.066
LRR [sensitive, ls]	466	489	1.4
LRR [sensitive, ls]	491	514	0.1
LRR [sensitive, ls]	491	514	2.1
LRR [sensitive, ls]	515	538	0.0027
LRR [sensitive, ls]	515	538	0.057
LRR [sensitive, ls]	539	562	2.5
LRR [sensitive, ls]	539	562	51
LRR [sensitive, ls]	563	586	0.3
LRR [sensitive, ls]	563	586	6.3
LRR [sensitive, ls]	587	610	0.0049
LRR [sensitive, ls]	587	610	0.1
LRR [sensitive, ls]	611	634	1.1
LRR [sensitive, ls]	611	634	24
LRR [sensitive, ls]	635	658	0.82
LRR [sensitive, ls]	635	658	17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	4	360	5e-29
FLS2 [A.thaliana]	11	675	1e-101
Xa21 [O. sativa]	14	675	2e-78
CLV2 [A. thaliana]	17	655	6e-62
Cf-9 [L. pimpinellifolium]	55	675	4e-60
FLS2 [A.thaliana]	78	629	5e-78
Cf-9 [L. pimpinellifolium]	83	284	2e-15
FLS2 [A.thaliana]	83	448	9e-48
Xa21 [O. sativa]	83	217	2e-11
FLS2 [A.thaliana]	90	675	1e-86
Xa21 [O. sativa]	225	675	5e-79
CLV2 [A. thaliana]	229	675	9e-45

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2493.m00134

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)