Report for 2507.m00096

 > 2507.m00096, length: 1047, copies: 2 

MQLLHYKKHSNKFPIPVLALALVLLINLASLTSSCTEQDRSSLLKFIRELSQDGGLSASWQDGTDCCKWDGIACS

QDGTVTDVSLASRNLQGNISPSLGNLTGLLRLNLSHNMLSGALPQELVSSSTIIIVDVSFNRLNGGLNELPSSTP

IRPLQVLNISSNLFTGQFPSSIWDVMKNLVALNVSSNKFTGKIPTRFCDSSSNLSVLELCYNQFSGSIPSGLGNC

SMLKVLKAGHNKLSGTLPGELFNDVSLEYLSFPNNNLHGEIDGTQIAKLRNLVTLDLGGNQFIGKIPDSISQLKR

LEELHLDSNMMSGELPGTLGSCTNLSIIDLKHNNFSGDLGKVNFSALHNLKTLDLYFNNFTGTIPESIYSCSNLT

ALRLSGNHFHGELSPGIINLKYLSFFSLDDNKLTNITKALQILKSCSTITTLLIGHNFRGEVMPQDESIDGFGNL

QVLDINSCLLSGKIPLWLSRLTNLEMLLLNGNQLTGPIPRWIDSLNHLFYIDVSDNRLTEEIPITLMNLPMLRST

SDIAHLDPGAFELPVYNGPSFQYRTLTGFPTLLNLSHNNFIGVISPMIGQLEVLVVLDFSFNNLSGQIPQSICNL

TSLQVLHLSNNHLTGEIPPGLSNLNFLSAFNISNNDLEGPIPTGGQFDTFSNSSFEGNPKLCDSRFNHHCSSAEA

SSVSRKEQNKKIVLAISFGVFFGGICILLLLGCFFVSERSKRFITKNSSDNDGDLEAASFNSDSEHSLIMITRGK

GEEINLTFADIVKATNNFDKAHIIGCGGYGLVYKAELPDGSKIAIKKLNSEMCLTEREFSAEVDALSMAQHANLV

PFWGYCIQGNLRLLIYSLMENGSLDDWLHNWDDDASSFLDWPTRLKIAQGASQGLHYIHDVCKPHIVHRDIKSSN

ILLDKEFKSYIADFGLSRLVLPNITHVTTELVGTLGYIPPEYGQSWVATLRGDMYSFGVVLLELLTGRRPVPILS

TSEELVPWVHKMRSEGKQIEVLDPTLRGTGCEEQMLKVLETACKCVDCNPLKRPTIMEVVTCLDSIGTEIKI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	127	0.5
LRR [Pfam ls]	153	177	3.4
LRR [Pfam ls]	178	201	3.5
LRR [Pfam ls]	203	226	0.22
LRR [Pfam ls]	276	299	0.087
LRR [Pfam ls]	300	323	2
LRR [Pfam ls]	324	348	4.6
LRR [Pfam ls]	349	372	0.023
LRR [Pfam ls]	373	396	0.42
LRR [Pfam ls]	449	472	0.12
LRR [Pfam ls]	473	496	0.13
LRR [Pfam ls]	497	520	1.4
LRR [Pfam ls]	578	601	0.27
LRR [Pfam fs]	602	625	9.4e-06
LRR [Pfam ls]	602	625	0.00014
Ser/Thr pkinase [Pfam fs]	768	972	1.5e-42
Ser/Thr pkinase [Pfam ls]	768	1035	2e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	4
LRR [sensitive, ls]	79	102	82
LRR [sensitive, ls]	103	127	0.024
LRR [sensitive, ls]	103	127	0.5
LRR [sensitive, ls]	153	177	0.16
LRR [sensitive, ls]	153	177	3.4
LRR [sensitive, ls]	178	201	0.17
LRR [sensitive, ls]	178	201	3.5
LRR [sensitive, ls]	203	226	0.01
LRR [sensitive, ls]	203	226	0.22
LRR [sensitive, ls]	227	250	3.4
LRR [sensitive, ls]	227	250	70
LRR [sensitive, ls]	251	275	0.56
LRR [sensitive, ls]	251	275	12
LRR [sensitive, ls]	276	299	0.0042
LRR [sensitive, ls]	276	299	0.087
LRR [sensitive, ls]	300	323	0.095
LRR [sensitive, ls]	300	323	2
LRR [sensitive, ls]	324	348	0.22
LRR [sensitive, ls]	324	348	4.6
LRR [sensitive, ls]	349	372	0.0011
LRR [sensitive, ls]	349	372	0.023
LRR [sensitive, ls]	373	396	0.02
LRR [sensitive, ls]	373	396	0.42
LRR [sensitive, ls]	397	419	2.1
LRR [sensitive, ls]	397	419	43
LRR [sensitive, ls]	449	472	0.0056
LRR [sensitive, ls]	449	472	0.12
LRR [sensitive, ls]	473	496	0.0064
LRR [sensitive, ls]	473	496	0.13
LRR [sensitive, ls]	497	520	0.069
LRR [sensitive, ls]	497	520	1.4
LRR [sensitive, ls]	554	577	0.98
LRR [sensitive, ls]	554	577	20
LRR [sensitive, ls]	578	601	0.013
LRR [sensitive, ls]	578	601	0.27
LRR [sensitive, ls]	602	625	6.9e-06
LRR [sensitive, ls]	602	625	0.00014
LRR [sensitive, ls]	626	659	1.6
LRR [sensitive, ls]	626	659	33

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	18	657	6e-74
CLV2 [A. thaliana]	38	724	2e-56
Xa21 [O. sativa]	39	859	9e-81
Cf-9 [L. pimpinellifolium]	59	642	2e-39
Cf-9 [L. pimpinellifolium]	68	705	7e-52
FLS2 [A.thaliana]	79	1038	1e-102
CLV2 [A. thaliana]	156	639	1e-34
Pto [L. esculentum]	752	1039	3e-47
Rpg1 [Hordeum vulgare]	765	1042	1e-36
Rpg1 [Hordeum vulgare]	765	1041	3e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out
putative TM domain	689	711	out -> in

Report for 2507.m00096

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)