Report for 2507.m00097

 > 2507.m00097, length: 1049, copies: 1 

MHPLHSPCKKHSNKFPIPVLALALVLLINLASLTSSCTEQDRSSLLRFLRELSQDGGLAASWQDGTDCCKWDGIT

CSQDSTVTDVSLASRSLQGRISPSLGNLPGLLRLNLSHNLLSGALPKELLSSSSLITIDVSFNRLDGDLDELPSS

TPARPLQVLNISSNLLAGQFPSSTWVVMKNMVALNVSNNSFSGHIPANFCTNSPYLSVLELSYNQLSGSIPPGFG

SCSRLRVLKAGHNNLSGTIPDEIFNATSLECLSFPNNDFQGTLEWANVVKLSKLATLDLGENNFSGNISESIGQL

NRLEELHLNNNKMFGSIPSNLSNCTSLKIIDLNNNNFSGELIYVNFSNLPNLKTLDLMRNNFSGEIPESIYTCSN

LTALRVSSNKLHGQLSKGLGNLKSLSFLSLAGNCLTNIANALQILSSSSNLTTLLIGHNFMNERMPDGSIDGFEN

LQVLSLSECSLSGKIPRWLSKLSRLEVLELDNNRLTGPIPDWISSLNFLFYLDISNNSLTGEIPMSLLQMPMLRS

DRAAAQLDRRAFQLPIYISASLLQYRKASAFPKVLNLGKNEFTGLIPPEIGLLKVLLSLNLSFNKLYGDIPQSIC

NLTDLLVLDLSSNNLTGTIPAALNNLNFLSEFNISYNDLEGPIPTGGQLDTFTNSSFYGNPKLCGPMLVRHCSSA

DGHLISKKQQNKKVILAIVFGVFFGAIVILMLSGYLLWSISGMSFRTKNRCSNDYTEALSSNISSEHLLVMLQQG

KEAEDKITFTGIMEATNNFNREHIIGCGGYGLVYRAELPDGSKLAIKKLNGEMCLMEREFSAEVETLSMAQHDNL

VPLLGYCIQGNSRLLIYSYMENGSLDDWLHNKDDGTSTILDWPRRLKIAKGASHGLSYIHNICKPRIVHRDIKSS

NILLDKEFKAYIADFGLSRLILPNKTHVTTELVGTLGYIPPEYGQAWVATLKGDVYSFGVVLLELLTGRRPVPIL

STSKELVPWVQEMISEGKQIEVLDSTLQGTGCEEQMLKVLETACKCVDGNPLMRPTMMEVVASLDSIDPDLKMQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	180	204	1.8
LRR [Pfam ls]	205	228	0.04
LRR [Pfam ls]	229	253	0.38
LRR [Pfam ls]	278	301	1.7
LRR [Pfam ls]	302	325	0.043
LRR [Pfam ls]	326	350	0.2
LRR [Pfam ls]	351	374	3.5
LRR [Pfam ls]	375	398	2.7
LRR [Pfam ls]	399	421	2.8
LRR [Pfam ls]	450	473	0.016
LRR [Pfam ls]	474	497	0.0031
LRR [Pfam ls]	498	521	3.1
LRR [Pfam ls]	580	603	3.3
LRR [Pfam ls]	604	627	0.031
Ser/Thr pkinase [Pfam fs]	769	1039	8.5e-49
Ser/Thr pkinase [Pfam ls]	769	1041	4.2e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	81	104	5
LRR [sensitive, ls]	81	104	100
LRR [sensitive, ls]	105	128	0.48
LRR [sensitive, ls]	105	128	10
LRR [sensitive, ls]	129	151	1.2
LRR [sensitive, ls]	129	151	25
LRR [sensitive, ls]	155	179	0.73
LRR [sensitive, ls]	155	179	15
LRR [sensitive, ls]	180	204	0.087
LRR [sensitive, ls]	180	204	1.8
LRR [sensitive, ls]	205	228	0.0019
LRR [sensitive, ls]	205	228	0.04
LRR [sensitive, ls]	229	253	0.018
LRR [sensitive, ls]	229	253	0.38
LRR [sensitive, ls]	278	301	0.082
LRR [sensitive, ls]	278	301	1.7
LRR [sensitive, ls]	302	325	0.0021
LRR [sensitive, ls]	302	325	0.043
LRR [sensitive, ls]	326	350	0.0097
LRR [sensitive, ls]	326	350	0.2
LRR [sensitive, ls]	351	374	0.17
LRR [sensitive, ls]	351	374	3.5
LRR [sensitive, ls]	375	398	0.13
LRR [sensitive, ls]	375	398	2.7
LRR [sensitive, ls]	399	421	0.13
LRR [sensitive, ls]	399	421	2.8
LRR [sensitive, ls]	425	449	0.82
LRR [sensitive, ls]	425	449	17
LRR [sensitive, ls]	450	473	0.00078
LRR [sensitive, ls]	450	473	0.016
LRR [sensitive, ls]	474	497	0.00015
LRR [sensitive, ls]	474	497	0.0031
LRR [sensitive, ls]	498	521	0.15
LRR [sensitive, ls]	498	521	3.1
LRR [sensitive, ls]	556	579	1.2
LRR [sensitive, ls]	556	579	25
LRR [sensitive, ls]	580	603	0.16
LRR [sensitive, ls]	580	603	3.3
LRR [sensitive, ls]	604	627	0.0015
LRR [sensitive, ls]	604	627	0.031
LRR [sensitive, ls]	628	661	3.4
LRR [sensitive, ls]	628	661	70

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	14	513	6e-39
FLS2 [A.thaliana]	20	644	9e-69
CLV2 [A. thaliana]	40	664	3e-54
Xa21 [O. sativa]	41	855	8e-85
Cf-9 [L. pimpinellifolium]	61	752	3e-48
FLS2 [A.thaliana]	77	292	6e-20
FLS2 [A.thaliana]	80	1039	1e-108
Cf-9 [L. pimpinellifolium]	100	714	9e-63
FLS2 [A.thaliana]	279	667	1e-32
FLS2 [A.thaliana]	375	645	8e-22
Rpg1 [Hordeum vulgare]	756	1042	3e-39
Pto [L. esculentum]	764	1040	4e-47
Rpg1 [Hordeum vulgare]	766	1043	1e-31

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	15	37	out -> in
putative TM domain	691	713	in -> out

Report for 2507.m00097

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)