Report for 2507.m00099

 > 2507.m00099, length: 1063, copies: 1 

MQKQQQLHSSCKKCSNRCFIDFLRFNLAFALLLLLSLASPTSSCTEQERSSLLQFLSGLSNDGGLAVSWRNAADC

CKWEGVTCSADGTVTDVSLASKGLEGRISPSLGNLTGLLRLNLSHNSLSGGLPLELMASSSITVLDISFNHLKGE

IHELPSSTPVRPLQVLNISSNSFTGQFPSATWEMMKNLVMLNASNNSFTGHIPSNFCSSSASLTALALCYNHLSG

SIPPGFGNCLKLRVLKVGHNNLSGNLPGDLFNATSLEYLSFPNNELNGVINGTLIVNLRNLSTLDLEGNNITGWI

PDSIGQLKRLQDLHLGDNNISGELPSALSNCTHLITINLKRNNFSGNLSNVNFSNLSNLKTLDLMGNKFEGTVPE

SIYSCTNLVALRLSSNNLQGQLSPKISNLKSLTFLSVGCNNLTNITNMLWILKDSRNLTTLLIGTNFYGEAMPED

NSIDGFQNLKVLSIANCSLSGNIPLWLSKLEKLEMLFLLDNRLSGSIPPWIKRLESLFHLDLSNNSLIGGIPASL

MEMPMLITKKNTTRLDPRVFELPIYRSAAGFQYRITSAFPKVLNLSNNNFSGVIPQDIGQLKSLDILSLSSNNLS

GEIPQQLGNLTNLQVLDLSSNHLTGAIPSALNNLHFLSTFNVSCNDLEGPIPNGAQFSTFTNSSFYKNPKLCGHI

LHRSCRSEQAASISTKSHNKKAIFATAFGVFFGGIAVLLFLAYLLATVKGTDCITNNRSSENADVDATSHKSDSE

QSLVIVSQNKGGKNKLTFADIVKATNNFDKENIIGCGGYGLVYKADLPDGTKLAIKKLFGEMCLMEREFTAEVEA

LSMAQHDNLVPLWGYCIQGNSRLLIYSYMENGSLDDWLHNRDDDASTFLDWPKRLKIAQGAGRGLSYIHDACKPH

IIHRDIKSSNILLDKEFKAYVADFGLARLILANKTHVTTELVGTLGYIPPEYGQGWVATLKGDIYSFGVVLLELL

TGRRPVHILSSSKELVKWVQEMKSEGNQIEVLDPILRGTGYDEQMLKVLETACKCVNCNPCMRPTIKEVVSCLDS

IDAKLQMQNSVKT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	112	135	4.4
LRR [Pfam ls]	136	158	1.7
LRR [Pfam ls]	187	210	0.35
LRR [Pfam ls]	212	235	2.3
LRR [Pfam ls]	236	259	0.63
LRR [Pfam ls]	285	308	0.32
LRR [Pfam ls]	309	332	0.011
LRR [Pfam ls]	358	381	2.5
LRR [Pfam ls]	382	405	0.099
LRR [Pfam ls]	458	481	0.69
LRR [Pfam ls]	482	505	8.8
LRR [Pfam ls]	506	529	0.22
LRR [Pfam ls]	564	587	0.45
LRR [Pfam ls]	588	611	0.047
LRR [Pfam fs]	612	635	4.7e-05
LRR [Pfam ls]	612	635	0.00078
Ser/Thr pkinase [Pfam fs]	778	982	2.6e-46
Ser/Thr pkinase [Pfam ls]	778	1050	9.2e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	112	135	0.21
LRR [sensitive, ls]	112	135	4.4
LRR [sensitive, ls]	136	158	0.084
LRR [sensitive, ls]	136	158	1.7
LRR [sensitive, ls]	162	186	0.72
LRR [sensitive, ls]	162	186	15
LRR [sensitive, ls]	187	210	0.017
LRR [sensitive, ls]	187	210	0.35
LRR [sensitive, ls]	212	235	0.11
LRR [sensitive, ls]	212	235	2.3
LRR [sensitive, ls]	236	259	0.03
LRR [sensitive, ls]	236	259	0.63
LRR [sensitive, ls]	260	284	0.75
LRR [sensitive, ls]	260	284	16
LRR [sensitive, ls]	285	308	0.015
LRR [sensitive, ls]	285	308	0.32
LRR [sensitive, ls]	309	332	0.00055
LRR [sensitive, ls]	309	332	0.011
LRR [sensitive, ls]	333	357	0.59
LRR [sensitive, ls]	333	357	12
LRR [sensitive, ls]	358	381	0.12
LRR [sensitive, ls]	358	381	2.5
LRR [sensitive, ls]	382	405	0.0047
LRR [sensitive, ls]	382	405	0.099
LRR [sensitive, ls]	406	428	0.72
LRR [sensitive, ls]	406	428	15
LRR [sensitive, ls]	458	481	0.033
LRR [sensitive, ls]	458	481	0.69
LRR [sensitive, ls]	482	505	0.42
LRR [sensitive, ls]	482	505	8.8
LRR [sensitive, ls]	506	529	0.011
LRR [sensitive, ls]	506	529	0.22
LRR [sensitive, ls]	564	587	0.022
LRR [sensitive, ls]	564	587	0.45
LRR [sensitive, ls]	588	611	0.0022
LRR [sensitive, ls]	588	611	0.047
LRR [sensitive, ls]	612	635	3.8e-05
LRR [sensitive, ls]	612	635	0.00078
LRR [sensitive, ls]	636	658	3.6
LRR [sensitive, ls]	636	658	75

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	20	869	1e-84
CLV2 [A. thaliana]	21	672	1e-55
Cf-9 [L. pimpinellifolium]	23	720	8e-69
FLS2 [A.thaliana]	46	652	4e-75
FLS2 [A.thaliana]	88	1054	1e-108
FLS2 [A.thaliana]	207	668	6e-44
Rpg1 [Hordeum vulgare]	765	1051	2e-35
Pto [L. esculentum]	770	1061	1e-47
Rpg1 [Hordeum vulgare]	775	1052	6e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	698	720	out -> in

Report for 2507.m00099

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)