Report for 2507.m00100

 > 2507.m00100, length: 1030, copies: 1 

MTYLGHALVLLLFLASPTSSCTEQERNSLIQFLTGLSKDGGLGMSWKNGTDCCAWEGITCNPNRMVTDVFLASRG

LEGVISPSLGNLTGLMRLNLSHNLLSGGLPLELVSSSSIVVLDVSFNYMTGGMSDLPSSTPDRPLQVLNISSNLF

TGIFPSTTWQVMKSLVAINASTNSFTGNIPTSFCVSAPSFALLELSNNQFSGGIPPGLGNCSKLTFLSTGRNNLS

GTLPYELFNITSLKHLSFPNNQLEGSIEGIMKLINLVTLDLGGNKLIGSIPDSIGQLKRLEKLHLDNNNMSGELP

WTLSDCTNLVTIDLKSNSFSGKLTNVNFSTLPNLKTLDVVWNNFSGTVPESIYSCRNLTALRLSYNGFHGQLSER

IGNLQYLSFLSIVNISLTNITRTIQVLQSCRNLTSLLIGRNFKQETMPEGDIIDGFENLQVLSLANCMLSGRIPH

WLSKLKNLAVLFLYNNQFTGQIPDWISSLNFLFYLDLSSNSLSGEIPKALMEMPMFKTDNVEPRVFELPVFTAPL

LQYRRTSALPKVLNLGINNFTGVIPKEIGQLKALLLLNLSSNKFSGGIPESICNITNLQVLDISSNDLTGPIPAA

LNKLNFLSAFNVSNNDLEGSVPTVGQLSTFPNSSFDGNPKLCGPMLVHHCGSDKTSYVSKKRHNKTAILALAFGV

FFGGITILFLLARLILFLRGKNFVTENRRCRNDGTEETLSNIKSEQTLVMLSQGKGEQTKLTFTDLKATKNFDKE

NIIGCGGYGLVYKAELSDGSMVAIKKLNSDMCLMEREFSAEVDALSTAQHDNLVPLWGYCIQGNSMLLIYSYMEN

GSLDDWLHNRNDDASSFLNWPMRLKIAQGASQGISYIHDVCKPQIVHRDIKCSNVLLDKEFKAHIADFGLSRLIL

PNRTHVTTELVGTFGYIPPEYGQGWVATLRGDMYSFGVVLLELLTGRRPVPILSSSKQLVEWVQEMISEGKYIEV

LDPTLRGTGYEKQMVKVLEVACQCVNHNPGMRPTIQEVVSCLDIIGTELQTTKLN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	189	212	0.22
LRR [Pfam ls]	260	283	0.031
LRR [Pfam ls]	284	307	0.38
LRR [Pfam ls]	308	332	7.1
LRR [Pfam ls]	357	380	4
LRR [Pfam ls]	433	456	0.027
LRR [Pfam ls]	457	480	0.12
LRR [Pfam ls]	481	504	0.6
LRR [Pfam ls]	558	581	2.3
LRR [Pfam ls]	582	605	0.0039
Ser/Thr pkinase [Pfam fs]	747	1019	8.1e-48
Ser/Thr pkinase [Pfam ls]	747	1019	2.4e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	89	112	0.72
LRR [sensitive, ls]	89	112	15
LRR [sensitive, ls]	113	135	1.7
LRR [sensitive, ls]	113	135	34
LRR [sensitive, ls]	139	163	0.53
LRR [sensitive, ls]	139	163	11
LRR [sensitive, ls]	164	187	3.9
LRR [sensitive, ls]	164	187	80
LRR [sensitive, ls]	189	212	0.011
LRR [sensitive, ls]	189	212	0.22
LRR [sensitive, ls]	237	259	0.67
LRR [sensitive, ls]	237	259	14
LRR [sensitive, ls]	260	283	0.0015
LRR [sensitive, ls]	260	283	0.031
LRR [sensitive, ls]	284	307	0.018
LRR [sensitive, ls]	284	307	0.38
LRR [sensitive, ls]	308	332	0.34
LRR [sensitive, ls]	308	332	7.1
LRR [sensitive, ls]	333	356	0.64
LRR [sensitive, ls]	333	356	13
LRR [sensitive, ls]	357	380	0.19
LRR [sensitive, ls]	357	380	4
LRR [sensitive, ls]	433	456	0.0013
LRR [sensitive, ls]	433	456	0.027
LRR [sensitive, ls]	457	480	0.0056
LRR [sensitive, ls]	457	480	0.12
LRR [sensitive, ls]	481	504	0.029
LRR [sensitive, ls]	481	504	0.6
LRR [sensitive, ls]	534	557	1.8
LRR [sensitive, ls]	534	557	38
LRR [sensitive, ls]	558	581	0.11
LRR [sensitive, ls]	558	581	2.3
LRR [sensitive, ls]	582	605	0.00019
LRR [sensitive, ls]	582	605	0.0039
LRR [sensitive, ls]	606	639	1.8
LRR [sensitive, ls]	606	639	37

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	2	638	2e-69
CLV2 [A. thaliana]	8	642	7e-55
Cf-9 [L. pimpinellifolium]	44	653	2e-64
FLS2 [A.thaliana]	64	274	6e-20
FLS2 [A.thaliana]	76	1017	1e-101
Xa21 [O. sativa]	193	838	1e-75
Xa21 [O. sativa]	536	627	5e-12
Pto [L. esculentum]	732	1014	8e-46
Rpg1 [Hordeum vulgare]	744	1021	5e-35
Rpg1 [Hordeum vulgare]	744	1020	4e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	670	692	out -> in

Report for 2507.m00100

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)