Report for 2507.m00101

 > 2507.m00101, length: 1047, copies: 1 

MQPLQFSNKNYSNRFPITSFGLALALLLFLASPTSSCTEKESNSLIQFLAWLSKDGGLGMSWKNGTDCCVWEGIT

CNPNRTVNEVFLATRGLEGIISPSLGNLIGLMRLNLSHNSLSGGLPLELVSSSSIMILDVSFNYLTGDLSDLPSS

THDRPLQVLNISSNLFTGNFPSTTWEVMKSLVALNASNNSFTGKIPTSFCASAPSFALLDISYNQFSGGIPPGLS

NCSTLTLLSSGKNNLTGAIPYEIFDITSLKHLSFPNNQLEGSIDGITKLINLVTLDLGGNKFIGSIPHSIGQLKR

LEEFHLDNNNMSGELPSTLSDCTNLVTIDLKKNNFSGELTKVNFSTLPNLKTLDVVWNKFNGTIPESIYSCSNLT

ALRLSFNNFRGQLSEKIGNLKSLSFLSLVKNSLANITSTLQMLQSSKNLTTLIIAINFMHETIPLDDSIDGFENL

QVLSLYGCSLSGKIPHWLSKLTNLEMLFLHDNQLTGQIPIWISSLNFLFYLDITNNSLSGEIPTALMEMPMLKTD

NVAPKVFELPIFTAQSLQYRINSAFPKVLNLGINNFAGAIPKEIGQLKALLLLNLSSNKLSGQIPESICNLTNLQ

MLDLSNNNLTGTIPEALNKLHFLSAFNVSNNDLEGPVPTVGQLSTFPSSIFDGNPKLCGPMLANHCSSAQTSYIS

KKRHIKKAILAVTFGVFFGGIAILVLLAHLLTLLRSTSFLSKNRRYSNDGTEAPSSNLNSEQPLVMVPQGKGEQT

KLTFTDLLKATKNFDKENIIGCGGYGLVYKGELSDGSMLAIKKLNSDMCLMEREFSAEVDALSMAQHDNLVPLWG

YCIQGNSRFLIYSYMENGSLDDWLHNRDNDASSFLDWPMRLKIAQGASQGLAYIHDVCKPNIVHRDIKSSNILLD

KEFKAYVADFGLSRLILPNKTHVTTELVGTLGYVPPEYGQGWMATLRGDMYSFGVVLLELLTGRRPIPVLSASKE

LIEWVQEMRSKGKQIEVLDPTLRGTGHEEQMLKVLEVACQCVNHNPGMRPTIREVVSCLDIIGTELQTTELN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	155	179	5.9
LRR [Pfam ls]	180	204	4.9
LRR [Pfam ls]	205	228	0.46
LRR [Pfam ls]	276	299	0.11
LRR [Pfam ls]	300	323	1
LRR [Pfam ls]	324	348	6.8
LRR [Pfam ls]	373	396	0.5
LRR [Pfam ls]	449	472	0.0034
LRR [Pfam ls]	473	496	0.28
LRR [Pfam ls]	497	520	4.1
LRR [Pfam ls]	574	597	0.28
LRR [Pfam fs]	598	621	1.2e-05
LRR [Pfam ls]	598	621	0.00019
Ser/Thr pkinase [Pfam fs]	764	1036	2.2e-46
Ser/Thr pkinase [Pfam ls]	764	1036	6.2e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	105	128	0.53
LRR [sensitive, ls]	105	128	11
LRR [sensitive, ls]	129	151	1.8
LRR [sensitive, ls]	129	151	38
LRR [sensitive, ls]	155	179	0.28
LRR [sensitive, ls]	155	179	5.9
LRR [sensitive, ls]	180	204	0.24
LRR [sensitive, ls]	180	204	4.9
LRR [sensitive, ls]	205	228	0.022
LRR [sensitive, ls]	205	228	0.46
LRR [sensitive, ls]	253	275	0.66
LRR [sensitive, ls]	253	275	14
LRR [sensitive, ls]	276	299	0.0051
LRR [sensitive, ls]	276	299	0.11
LRR [sensitive, ls]	300	323	0.05
LRR [sensitive, ls]	300	323	1
LRR [sensitive, ls]	324	348	0.33
LRR [sensitive, ls]	324	348	6.8
LRR [sensitive, ls]	349	372	0.81
LRR [sensitive, ls]	349	372	17
LRR [sensitive, ls]	373	396	0.024
LRR [sensitive, ls]	373	396	0.5
LRR [sensitive, ls]	397	419	5.5
LRR [sensitive, ls]	397	419	110
LRR [sensitive, ls]	449	472	0.00016
LRR [sensitive, ls]	449	472	0.0034
LRR [sensitive, ls]	473	496	0.013
LRR [sensitive, ls]	473	496	0.28
LRR [sensitive, ls]	497	520	0.2
LRR [sensitive, ls]	497	520	4.1
LRR [sensitive, ls]	550	573	3.8
LRR [sensitive, ls]	550	573	79
LRR [sensitive, ls]	574	597	0.013
LRR [sensitive, ls]	574	597	0.28
LRR [sensitive, ls]	598	621	9.3e-06
LRR [sensitive, ls]	598	621	0.00019
LRR [sensitive, ls]	622	655	2
LRR [sensitive, ls]	622	655	41

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	20	640	1e-72
Xa21 [O. sativa]	25	855	3e-85
Cf-9 [L. pimpinellifolium]	60	666	3e-65
CLV2 [A. thaliana]	65	622	4e-41
Cf-9 [L. pimpinellifolium]	77	659	1e-42
CLV2 [A. thaliana]	80	669	2e-43
FLS2 [A.thaliana]	82	1034	1e-111
CLV2 [A. thaliana]	181	638	8e-44
FLS2 [A.thaliana]	428	651	1e-22
FLS2 [A.thaliana]	479	654	1e-16
Pto [L. esculentum]	748	1031	4e-48
Rpg1 [Hordeum vulgare]	751	1038	3e-37
Rpg1 [Hordeum vulgare]	761	1037	2e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	15	32	out -> in
putative TM domain	683	705	in -> out

Report for 2507.m00101

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)