Report for 2561.m00136

 > 2561.m00136, length: 433, copies: 1 

MGTLPPFPPLLLLVAVIFSFLSSSCFAVTSHEAAAIARRQLLNFEKHGDHVHIDIDIEIKVSNPRLAAAHRALHA

LKRALYSDPGNFTGDWAGPDVCAYNGVLCAPSPDNASASAVASLDMNAADVAGYLPREIGLLSDLAVLHLNSNRF

CGVIPEEVANMTRLYELDVSNNRLVGAFPGAVLRVPELSYLDIRFNDFDGPIPPELFLRPYDAIFLNNNRFTSGI

PDTIGRSTASVIVLANNDLGGCIPPTIGQAAATLDQFVFLNNSLTGCLPLESGLLANATVFDVSHNLLTGAIPAT

MGGLAKVEQLDLSHNTFTGVVPGDVCGLPALTNLSVSYNFIAGEDAQCSSALLDAKLDKSLEDEANCMGNVRPMQ

RSAGLTAGWSEEIKRGGIKIFNCSTLDSSYGLLRKIRSAVNKLLKQMTKHLSGSVVGP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	139	162	9.9
LRR [Pfam ls]	306	329	0.037

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	139	162	0.5
LRR [sensitive, ls]	139	162	9.9
LRR [sensitive, ls]	163	184	0.81
LRR [sensitive, ls]	163	184	16
LRR [sensitive, ls]	187	211	2.9
LRR [sensitive, ls]	187	211	56
LRR [sensitive, ls]	282	305	1.4
LRR [sensitive, ls]	282	305	27
LRR [sensitive, ls]	306	329	0.0019
LRR [sensitive, ls]	306	329	0.037

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	54	344	1e-18
FLS2 [A.thaliana]	72	339	2e-25
Xa21 [O. sativa]	72	345	5e-21
Xa21 [O. sativa]	97	344	3e-25
CLV2 [A. thaliana]	99	324	3e-13
Xa21 [O. sativa]	100	343	1e-18
Xa21 [O. sativa]	107	335	1e-19
CLV2 [A. thaliana]	111	343	2e-19
FLS2 [A.thaliana]	111	343	4e-19
Cf-9 [L. pimpinellifolium]	112	348	3e-14
Cf-9 [L. pimpinellifolium]	116	343	3e-14
FLS2 [A.thaliana]	116	433	6e-23
Cf-9 [L. pimpinellifolium]	119	343	1e-12
FLS2 [A.thaliana]	119	427	7e-27
CLV2 [A. thaliana]	125	343	5e-17
FLS2 [A.thaliana]	128	343	4e-23
Xa21 [O. sativa]	128	345	9e-15
CLV2 [A. thaliana]	140	344	2e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2561.m00136

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)