Report for 2580.m00136

 > 2580.m00136, length: 1294, copies: 2 

MVSNSFWLFILLVSFIPISAWAESRDISTLFTLRDSITEGKGFLRNWFDSETPPCSWSGITCIGHNVVAIDLSSV

PLYAPFPLCIGAFQSLVRLNFSGCGFSGELPEALGNLQNLQYLDLSNNELTGPIPISLYNLKMLKEMVLDYNSLS

GQLSPAIAQLQHLTKLSISMNSISGSLPPDLGSLKNLELLDIKMNTFNGSIPATFGNLSCLLHFDASQNNLTGSI

FPGITSLTNLLTLDLSSNSFEGTIPREIGQLENLELLILGKNDLTGRIPQEIGSLKQLKLLHLEECQFTGKIPWS

ISGLSSLTELDISDNNFDAELPSSMGELGNLTQLIAKNAGLSGNMPKELGNCKKLTVINLSFNALIGPIPEEFAD

LEAIVSFFVEGNKLSGRVPDWIQKWKNARSIRLGQNKFSGPLPVLPLQHLLSFAAESNLLSGSIPSHICQANSLH

SLLLHHNNLTGTIDEAFKGCTNLTELNLLDNHIHGEVPGYLAELPLVTLELSQNKFAGMLPAELWESKTLLEISL

SNNEITGPIPESIGKLSVLQRLHIDNNLLEGPIPQSVGDLRNLTNLSLRGNRLSGIIPLALFNCRKLATLDLSYN

NLTGNIPSAISHLTLLDSLILSSNQLSGSIPAEICVGFENEAHPDSEFLQHHGLLDLSYNQLTGQIPTSIKNCAM

VMVLNLQGNLLNGTIPVELGELTNLTSINLSFNEFVGPMLPWSGPLVQLQGLILSNNHLDGSIPAKIGQILPKIA

VLDLSSNALTGTLPQSLLCNNYLNHLDVSNNHLSGHIQFSCPDGKEYSSTLLFFNSSSNHFSGSLDESISNFTQL

STLDIHNNSLTGRLPSALSDLSSLNYLDLSSNNLYGAIPCGICNIFGLSFANFSGNYIDMYSLADCAAGGICSTN

GTDHKALHPYHRVRRAITICAFTFVIIIVLVLLAVYLRRKLVRSRPLAFESASKAKATVEPTSTDELLGKKSREP

LSINLATFEHALLRVTADDILKATENFSKVHIIGDGGFGTVYKAALPEGRRVAIKRLHGGHQFQGDREFLAEMET

IGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLEMWLRNRADALEALGWPDRLKICLGSARGLAFLHHGFVPHI

IHRDMKSSNILLDENFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGLTMKSTTKGDVYSFGVVMLELLT

GRPPTGQEEVQGGGNLVGWVRWMIARGKQNELFDPCLPVSSVWREQMARVLAIARDCTADEPFKRPTMLEVVKGL

KMTHGMECGPLVVTVSRDM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	90	113	0.082
LRR [Pfam ls]	114	137	0.0019
LRR [Pfam ls]	162	185	0.52
LRR [Pfam ls]	234	257	0.14
LRR [Pfam ls]	258	281	0.3
LRR [Pfam ls]	282	305	0.67
LRR [Pfam ls]	306	329	1.7
LRR [Pfam ls]	354	377	0.44
LRR [Pfam ls]	448	471	0.014
LRR [Pfam ls]	472	495	8.2
LRR [Pfam ls]	519	542	0.049
LRR [Pfam ls]	543	566	2.1
LRR [Pfam ls]	567	590	0.021
LRR [Pfam ls]	591	614	0.0019
LRR [Pfam ls]	615	639	4
LRR [Pfam ls]	723	747	1.3
LRR [Pfam ls]	748	771	6.6
LRR [Pfam ls]	824	847	0.034
LRR [Pfam ls]	848	872	7.6
Ser/Thr pkinase [Pfam fs]	1002	1277	1.5e-53
Ser/Thr pkinase [Pfam ls]	1002	1277	4.4e-54

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	90	113	0.0042
LRR [sensitive, ls]	90	113	0.082
LRR [sensitive, ls]	114	137	9.5e-05
LRR [sensitive, ls]	114	137	0.0019
LRR [sensitive, ls]	138	161	2.3
LRR [sensitive, ls]	138	161	46
LRR [sensitive, ls]	162	185	0.026
LRR [sensitive, ls]	162	185	0.52
LRR [sensitive, ls]	186	209	0.77
LRR [sensitive, ls]	186	209	15
LRR [sensitive, ls]	210	233	1.1
LRR [sensitive, ls]	210	233	21
LRR [sensitive, ls]	234	257	0.0074
LRR [sensitive, ls]	234	257	0.14
LRR [sensitive, ls]	258	281	0.015
LRR [sensitive, ls]	258	281	0.3
LRR [sensitive, ls]	282	305	0.034
LRR [sensitive, ls]	282	305	0.67
LRR [sensitive, ls]	306	329	0.087
LRR [sensitive, ls]	306	329	1.7
LRR [sensitive, ls]	330	353	3.7
LRR [sensitive, ls]	330	353	72
LRR [sensitive, ls]	354	377	0.023
LRR [sensitive, ls]	354	377	0.44
LRR [sensitive, ls]	378	401	4.7
LRR [sensitive, ls]	378	401	93
LRR [sensitive, ls]	402	421	4.6
LRR [sensitive, ls]	402	421	90
LRR [sensitive, ls]	448	471	0.0007
LRR [sensitive, ls]	448	471	0.014
LRR [sensitive, ls]	472	495	0.42
LRR [sensitive, ls]	472	495	8.2
LRR [sensitive, ls]	519	542	0.0025
LRR [sensitive, ls]	519	542	0.049
LRR [sensitive, ls]	543	566	0.11
LRR [sensitive, ls]	543	566	2.1
LRR [sensitive, ls]	567	590	0.0011
LRR [sensitive, ls]	567	590	0.021
LRR [sensitive, ls]	591	614	9.8e-05
LRR [sensitive, ls]	591	614	0.0019
LRR [sensitive, ls]	615	639	0.2
LRR [sensitive, ls]	615	639	4
LRR [sensitive, ls]	675	698	1
LRR [sensitive, ls]	675	698	21
LRR [sensitive, ls]	699	722	1.5
LRR [sensitive, ls]	699	722	30
LRR [sensitive, ls]	723	747	0.068
LRR [sensitive, ls]	723	747	1.3
LRR [sensitive, ls]	748	771	0.33
LRR [sensitive, ls]	748	771	6.6
LRR [sensitive, ls]	772	792	0.72
LRR [sensitive, ls]	772	792	14
LRR [sensitive, ls]	824	847	0.0017
LRR [sensitive, ls]	824	847	0.034
LRR [sensitive, ls]	848	872	0.38
LRR [sensitive, ls]	848	872	7.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	1280	1e-154
Xa21 [O. sativa]	1	631	1e-70
CLV2 [A. thaliana]	6	695	1e-55
Cf-9 [L. pimpinellifolium]	48	799	6e-67
Cf-9 [L. pimpinellifolium]	66	644	2e-48
CLV2 [A. thaliana]	67	415	2e-29
CLV2 [A. thaliana]	70	254	2e-11
CLV2 [A. thaliana]	90	539	6e-51
Xa21 [O. sativa]	90	395	2e-36
CLV2 [A. thaliana]	148	765	2e-57
CLV2 [A. thaliana]	166	863	9e-53
Cf-9 [L. pimpinellifolium]	190	866	2e-61
Cf-9 [L. pimpinellifolium]	232	883	4e-65
CLV2 [A. thaliana]	310	884	2e-44
Xa21 [O. sativa]	331	1088	3e-67
Cf-9 [L. pimpinellifolium]	402	884	7e-34
CLV2 [A. thaliana]	421	864	3e-47
CLV2 [A. thaliana]	496	883	8e-33
Xa21 [O. sativa]	591	881	2e-24
Pto [L. esculentum]	970	1272	2e-51
Rpg1 [Hordeum vulgare]	999	1286	9e-34
Rpg1 [Hordeum vulgare]	999	1275	3e-31

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	22	in -> out
putative TM domain	859	881	out -> in
putative TM domain	915	937	in -> out

Report for 2580.m00136

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)