Report for 2675.m00125

 > 2675.m00125, length: 675, copies: 2 

MPPPRLPCLAAFLALALVVVVCAAEPDADRAALLDFLAGLGGGRGRINWASSPRVCGNWTGVTCSGDGSRVVALR

LPGLGLSGPVPRGTLGRLTALQVLSLRANSLSGEFPEELLSLASLTGLHLQLNAFSGALPPELARLRALQVLDLS

FNGFNGTLPAALSNLTQLVALNLSNNSLSGRVPDLGLPALQFLNLSNNHLDGPVPTSLLRFNDTAFAGNNVTRPA

SASPAGTPPSGSPAAAGAPAKRRVRLSQAAILAIVVGGCVAVSAVIAVFLIAFCNRSGGGGDEEVSRVVSGKSGE

KKGRESPESKAVIGKAGDGNRIVFFEGPALAFDLEDLLRASAEVLGKGAFGTAYRAVLEDATTVVVKRLKEVSAG

RRDFEQQMELVGRIRHANVAELRAYYYSKDEKLLVYDFYSRGSVSNMLHVPICSHVKLEPSKFIFLVLDFCLKLA

MLIENELIGKRGEDRTPLNWETRVRIALGAARGIAHIHTENNGKFVHGNIKASNVFLNNQQYGCVSDLGLASLMN

PITARSRSLGYCAPEVTDSRKASQCSDVYSFGVFILELLTGRSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFD

VELMRYPNIEEEMVEMLQIAMACVSRTPERRPKMSDVVRMLEDVRRTDTGTRTSTEASTPVVDVQNKAESSSAAH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	95	118	9.2
LRR [Pfam ls]	143	166	0.021
LRR [Pfam ls]	167	188	2.1
LRR [Pfam ls]	189	212	2.5
Ser/Thr pkinase [Pfam fs]	339	569	1.5e-21
Ser/Thr pkinase [Pfam ls]	339	641	1e-16

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	118	0.47
LRR [sensitive, ls]	95	118	9.2
LRR [sensitive, ls]	119	142	0.69
LRR [sensitive, ls]	119	142	14
LRR [sensitive, ls]	143	166	0.0011
LRR [sensitive, ls]	143	166	0.021
LRR [sensitive, ls]	167	188	0.11
LRR [sensitive, ls]	167	188	2.1
LRR [sensitive, ls]	189	212	0.13
LRR [sensitive, ls]	189	212	2.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	29	218	4e-11
Xa21 [O. sativa]	29	205	7e-22
FLS2 [A.thaliana]	58	222	2e-19
Xa21 [O. sativa]	58	208	2e-13
FLS2 [A.thaliana]	66	208	7e-16
FLS2 [A.thaliana]	66	208	8e-14
Xa21 [O. sativa]	66	424	2e-20
Cf-9 [L. pimpinellifolium]	69	209	3e-12
Xa21 [O. sativa]	69	208	4e-18
CLV2 [A. thaliana]	70	208	9e-18
CLV2 [A. thaliana]	71	208	4e-15
CLV2 [A. thaliana]	73	212	1e-15
Cf-9 [L. pimpinellifolium]	74	239	3e-12
FLS2 [A.thaliana]	74	208	2e-17
FLS2 [A.thaliana]	75	222	6e-17
FLS2 [A.thaliana]	81	645	3e-39
FLS2 [A.thaliana]	81	209	3e-17
FLS2 [A.thaliana]	81	226	1e-14
FLS2 [A.thaliana]	81	208	2e-14
Xa21 [O. sativa]	81	213	6e-13
FLS2 [A.thaliana]	82	208	4e-12
FLS2 [A.thaliana]	90	208	3e-15
Pto [L. esculentum]	332	642	5e-26
Rpg1 [Hordeum vulgare]	344	644	6e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	24	out -> in
putative TM domain	256	278	in -> out

Report for 2675.m00125

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)