Report for 2678.m00130

 > 2678.m00130, length: 1292, copies: 1 

MAEGALASTIVRQVLTKFGSSVWDELALLCTFRADLAAMEAQFATIRAVLADAAVRDWLRRLRDVAHDIDDFLDA

CHTDLRRGEGGGDCSVCGGLTPRSFAMAHRLRSLRRELGAVAASKDRFSLSPDARPPASRQLPSVPLMRETISMV

DEAKTVGRSADKERLMRMVLDAAGDDDDDDDDGVSVIPIVGIGGLGKTTLAQLAFNDRRANDEVFDPRIWVSMSA

GFSLATLVQAVHPIVAAPSERCDLATTTTTNLEAIARFLSMAFTGNKYLLVLDDVWSESHDEWERLRLLLRGGKR

GSKIIVTTRSRRIGMMVGTVPPLMLKSLSDEDCWELFKRKAFEEADEELYPKLVRIGKEIVPKCGGVPLAAKALG

SMLRFKRNEESWIAVRDSEIWQLDKEETILPSLKLSYDQMPPVLKQCFAYCSVFPRNHEIDKGKLIQQWVALGFV

EPSKYGCQPVSDKADDCFEHLLWMSFLQEVDQHDLSKKGLEVDGRVKYKIHDLVHDLAQSVAGDEVQIISAKRVN

GRTEACRYASLHDDMGSTDVLWSMLRKVRAFHSWGRSLDINLFLHSRFLRVLDLRGSQIMELPQSVGKLKHLRYL

DLSSSLISTLPNCISSLHNLQTLHLYNCINLNVLPMSVCALENLEILNLSACNFHSLPDSIGHLQNLQDLNLSLC

SFLVTLPSSIGTLQSLHLLNLKGCGNLEILPDTICSLQNLHFLNLSRCGVLQALPKNIGNLSNLLHLNLSQCTDL

ESIPTSIGRIKSLHILDLSHCSSLSELPGSIGGLHELQILILSHHASSLALPVSTSHLPNLQTLDLSWNLSLEEL

PESIGNLHSLKTLILFQCWSLRKLPESITNLMMLESLNFVGCENLAKLPDGMTRITNLKHLRNDQCRSLKQLPNG

FGRWTKLETLSLLMIGDKHSSITELKDLNNLTGELRIECWSHKMDLTTAAKRANWRNKKKLSKLTLLWTIPCSAD

DFENVETFLEVLVPPENLEVLEIDGYMGTRFPSWMMKSMESWLPNLVSLDLSNIPNCSCLPPLRHIPYLQSLHLR

YMAGVHSMSSEILVKRQKCVLYQSLKELHFEDMPNLETWPTSAATDDRATQPEGSMFPVLKTVTATGCPKLRPKP

CLPDAITDLSISDSSEILSVRKMFGSSSSTSASLLRRLWIRKSDVSSSEWKLLQHRPKLEELTIEYCEMLRVLAE

PIRYLTTLRKLKISNCTELDALPEWIGDLVALESLQISCCPKLVSIPKGLQHLTALEELTVTACSSELNENCRKD

TGKDWFKICHIPNIVIS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
NB-ARC [Pfam fs]	139	455	9.1e-76
NB-ARC [Pfam ls]	139	455	2.5e-76
LRR [Pfam ls]	573	595	1.3
LRR [Pfam ls]	596	618	0.063
LRR [Pfam ls]	619	642	7.6
LRR [Pfam ls]	643	665	0.075
LRR [Pfam ls]	714	737	0.38
LRR [Pfam ls]	738	761	6.6
LRR [Pfam ls]	762	785	0.051
LRR [Pfam ls]	810	833	0.031
LRR [Pfam ls]	1231	1254	0.47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	573	595	0.065
LRR [sensitive, ls]	573	595	1.3
LRR [sensitive, ls]	596	618	0.0032
LRR [sensitive, ls]	596	618	0.063
LRR [sensitive, ls]	619	642	0.39
LRR [sensitive, ls]	619	642	7.6
LRR [sensitive, ls]	643	665	0.0038
LRR [sensitive, ls]	643	665	0.075
LRR [sensitive, ls]	666	689	0.54
LRR [sensitive, ls]	666	689	11
LRR [sensitive, ls]	690	713	0.58
LRR [sensitive, ls]	690	713	11
LRR [sensitive, ls]	714	737	0.019
LRR [sensitive, ls]	714	737	0.38
LRR [sensitive, ls]	738	761	0.34
LRR [sensitive, ls]	738	761	6.6
LRR [sensitive, ls]	762	785	0.0026
LRR [sensitive, ls]	762	785	0.051
LRR [sensitive, ls]	810	833	0.0016
LRR [sensitive, ls]	810	833	0.031
LRR [sensitive, ls]	834	857	0.96
LRR [sensitive, ls]	834	857	19
LRR [sensitive, ls]	858	878	2.9
LRR [sensitive, ls]	858	878	56
LRR [sensitive, ls]	1020	1042	0.64
LRR [sensitive, ls]	1020	1042	13
LRR [sensitive, ls]	1183	1206	2.1
LRR [sensitive, ls]	1183	1206	42
LRR [sensitive, ls]	1207	1230	0.59
LRR [sensitive, ls]	1207	1230	12
LRR [sensitive, ls]	1231	1254	0.024
LRR [sensitive, ls]	1231	1254	0.47

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Mla1 [Hordeum vulgare].	11	777	3e-42
I2 [L. esculentum]	46	670	4e-72
Pi-ta [Oryza sativa]	52	862	8e-30
Xa1 [Oryza sativa]	95	1266	9e-58
Pib [Oryza sativa].	121	940	1e-40
RPS2 [A. thaliana]	165	850	2e-46
L6 [L. usitatissimum]	180	1257	3e-14
N [N. glutinosa]	182	875	4e-38
RPM1 [A. thaliana]	186	869	7e-45
FLS2 [A.thaliana]	511	936	3e-22
Cf-9 [L. pimpinellifolium]	525	862	3e-14
FLS2 [A.thaliana]	568	935	7e-16
CLV2 [A. thaliana]	572	934	1e-20
FLS2 [A.thaliana]	574	852	6e-18
N [N. glutinosa]	574	789	4e-21
RPP5 [A. thaliana]	574	912	3e-26
RPP5 [A. thaliana]	574	912	1e-17
Xa21 [O. sativa]	577	941	9e-20
Xa21 [O. sativa]	577	795	1e-13
CLV2 [A. thaliana]	586	1096	2e-23
FLS2 [A.thaliana]	587	883	8e-17
Xa21 [O. sativa]	587	840	2e-18
Xa21 [O. sativa]	587	874	7e-17
Xa21 [O. sativa]	587	935	7e-17
Xa21 [O. sativa]	587	826	1e-15
FLS2 [A.thaliana]	591	897	6e-15
RPP5 [A. thaliana]	594	1264	1e-16
RPP5 [A. thaliana]	642	894	3e-22
Cf-9 [L. pimpinellifolium]	654	1028	3e-11
I2 [L. esculentum]	712	1266	3e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2678.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)