Report for 2708.m00128

 > 2708.m00128, length: 494, copies: 1 

MVASALSATAAATVVVAVVAVLVAVCRGEFTVVVPDSSSSAALVNAPQTGLSDRARTDPAEQRAVQEVMAATGNG

WASGIADVCRGRWHGIECVPDRGEVYHVVSLSFGALSDDTAFPACDAARATLSPAVLALPHLRSLFFYRCFTANP

QPVPAFLGRLGPAFRSLVLRENGHVGAIPPELGNLTALRVLDLHGNNLTSAIPATVQSLAHLQLLDLSYNQLAGE

VPPFKFQHLSILDLSHNALQGGVPASLGQCRSLLKFDLSQNRFAGTIPDALGDLSDLILLDLSHNALSGPIPAAL

GRLSSLRSLILGDNRMQFTTVPGDIFAGLRALTTLVLSGMGLEGSLPESIGELGHLRVLRLDNNEFTGVIPASFR

RLERASELRVDGNRLVGPIPFGKQMMWRLGKKLRVGGNEGLCYDAKQQGLEGVVALAGVADCDSVRSRTTQHLGG

RLRNTGGLPAAAAAAPSVGVGAGVCVGSWHVFVGVLVSLHLARL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	187	210	0.094
LRR [Pfam ls]	211	232	0.67
LRR [Pfam ls]	233	256	0.15
LRR [Pfam ls]	257	280	5.6
LRR [Pfam ls]	281	304	0.12
LRR [Pfam ls]	305	330	0.075
LRR [Pfam ls]	355	378	0.01

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	163	186	0.66
LRR [sensitive, ls]	163	186	13
LRR [sensitive, ls]	187	210	0.0048
LRR [sensitive, ls]	187	210	0.094
LRR [sensitive, ls]	211	232	0.034
LRR [sensitive, ls]	211	232	0.67
LRR [sensitive, ls]	233	256	0.0078
LRR [sensitive, ls]	233	256	0.15
LRR [sensitive, ls]	257	280	0.28
LRR [sensitive, ls]	257	280	5.6
LRR [sensitive, ls]	281	304	0.0059
LRR [sensitive, ls]	281	304	0.12
LRR [sensitive, ls]	305	330	0.0038
LRR [sensitive, ls]	305	330	0.075
LRR [sensitive, ls]	331	354	0.77
LRR [sensitive, ls]	331	354	15
LRR [sensitive, ls]	355	378	0.00052
LRR [sensitive, ls]	355	378	0.01

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	86	395	8e-33
Xa21 [O. sativa]	134	395	3e-20
Xa21 [O. sativa]	135	395	1e-28
FLS2 [A.thaliana]	153	395	6e-26
FLS2 [A.thaliana]	153	331	1e-18
Xa21 [O. sativa]	153	395	1e-25
FLS2 [A.thaliana]	158	394	3e-30
Cf-9 [L. pimpinellifolium]	160	398	4e-16
CLV2 [A. thaliana]	162	415	9e-26
CLV2 [A. thaliana]	163	395	3e-21
CLV2 [A. thaliana]	163	394	1e-19
FLS2 [A.thaliana]	166	414	6e-30
Cf-9 [L. pimpinellifolium]	167	394	2e-22
Cf-9 [L. pimpinellifolium]	167	395	6e-20
Xa21 [O. sativa]	167	385	1e-30
FLS2 [A.thaliana]	172	395	5e-33
FLS2 [A.thaliana]	172	395	4e-29
Cf-9 [L. pimpinellifolium]	178	395	2e-15
Cf-9 [L. pimpinellifolium]	182	395	1e-13
Cf-9 [L. pimpinellifolium]	186	395	4e-20
CLV2 [A. thaliana]	191	388	2e-14
CLV2 [A. thaliana]	215	395	3e-12
FLS2 [A.thaliana]	233	395	8e-15
Xa21 [O. sativa]	258	404	5e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	2	24	in -> out

Report for 2708.m00128

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)