Report for 2712.m00179

 > 2712.m00179, length: 1410, copies: 2 

MAIRLMRRLGLPLLPVLLTIAAASSSDEASLLAFKAGLTGSNSSALASWNSSGASFCNWEGVTCSRRRPTRVASL

SLPSSNLAGTLSPAIGNLTFPRRLNLSSNGLYGEIPTSIGRLRRLQWLNLSYNSFSGAFPVNLTSCISLKILDLD

YNQLGGIIPVELGNTLTQLQMLLLTNNSIIGPIPPSLANLSLLQDLYLDYNHLEGLIPPCLGNFPVLHELSLEAN

MLTGEFPHSLWNLSALRVIGVGLNMLQGSIPANIGDKFPAMRFFGLHENRFHGAIPSSLSNLSRLTDLYLADNNF

TGFVPPTLGMLHSLKYLYIGTNQLEADNGKGSEFVTSLANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLE

NNSFSGTIPHDISNLIGLRLLDLGFNPISGVIPESIGKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLLAFHTN

LEGPIPATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSLSGHLPSEVGTLANLNQLILSGNQLS

GQIPNSIGNCEVLEFLLLDNNSFGGDMPQSLTNLKGLNVLNLTVNKLSGRIPNAISNIGNLQYLCLAHNNFSGPI

PAALQNFTLLKQLDVSFNNLQGEVPVKGVFRNLTFSSVVGNDNLCGGIPQLHLPPCPILDVSKNKNQHLKSLAIA

LPTTGAMLVLVSVIVLILLHNRKLKRRQNRQATSLVIEEQYQRVSYYALSRGSNDFSEANLLGKGRYGSVYRCTL

DNEDALVAVKVFDLQQLGSSKSFEAECEALRRVRHRCLIKIITCCSSIDPQGQEFKALVLEFMPNGSLDGWIHPK

SSKCSPSNTLSFSQRLNIVIDIFEAMDYLHNHCQPSIIHCDMKPSNILLAEDMNAKVGDFGISKILPKSITKIHL

NSKSSIGIRGSIGYIAPEYGEGSAASKLGDIYSLGIILLEMFTGTSPTDDMFKDSLNLHEFATAAFPDRALEIAD

QTIWLHETNYTDATDASMTRGIIQQSLVSLFGLGISCSKQQPRERMVLADAVSKIHAIRDEYFKSRVGSAASWSW

NSSANSFCSWEGVTCSHRRRPTSVVALDLPSSDLAGTLSPAIGNLTFLRRLNLSSNDLHSEIPQSVSRLRRLRVL

DMDHNAFSGEFPTNLTTCVRLTTVYLQYNQLGDRIPGIAINGNHLEGMIPPGIGSIAGLRNLTYASIAGDDKLCS

GMPQLHLAPCPILDRLTCLAKEDYGSVNRCALEDEGASVTTAVKMFNLQMSGSSRSFEAECEALRRVRHRCLIKI

ITCCSSIDQQGQEFKALVFEFMPNEDKSAKVGDLGISKILPNSTTKTLQNSKSSIGIRGSIGYIAPEANETDVTN

ASTKRRIIQQCLVAVLRLGISCSKQQPRDRVLLADAVSEIHAIRDEYLRSWMVGIELNVG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	139	1.1
LRR [Pfam ls]	143	167	1.6
LRR [Pfam ls]	168	191	1.8
LRR [Pfam ls]	192	215	0.59
LRR [Pfam ls]	289	312	3.1
LRR [Pfam ls]	343	366	2.1
LRR [Pfam ls]	368	391	0.066
LRR [Pfam ls]	392	415	0.0097
LRR [Pfam ls]	416	439	0.38
LRR [Pfam ls]	464	488	1.6
LRR [Pfam ls]	513	536	0.26
LRR [Pfam ls]	585	608	0.014
LRR [Pfam ls]	609	634	2
Ser/Thr pkinase [Pfam fs]	731	950	9.2e-51
Ser/Thr pkinase [Pfam ls]	731	1003	7.8e-43
LRR [Pfam ls]	1097	1120	1.3
LRR [Pfam ls]	1121	1141	2
Ser/Thr pkinase [Pfam fs]	1224	1299	0.011
Ser/Thr pkinase [Pfam fs]	1305	1342	0.13

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	71	94	2.1
LRR [sensitive, ls]	71	94	42
LRR [sensitive, ls]	95	118	1.1
LRR [sensitive, ls]	95	118	22
LRR [sensitive, ls]	119	139	0.055
LRR [sensitive, ls]	119	139	1.1
LRR [sensitive, ls]	143	167	0.08
LRR [sensitive, ls]	143	167	1.6
LRR [sensitive, ls]	168	191	0.09
LRR [sensitive, ls]	168	191	1.8
LRR [sensitive, ls]	192	215	0.03
LRR [sensitive, ls]	192	215	0.59
LRR [sensitive, ls]	216	239	0.51
LRR [sensitive, ls]	216	239	10
LRR [sensitive, ls]	240	264	3.7
LRR [sensitive, ls]	240	264	73
LRR [sensitive, ls]	265	288	3.2
LRR [sensitive, ls]	265	288	63
LRR [sensitive, ls]	289	312	0.16
LRR [sensitive, ls]	289	312	3.1
LRR [sensitive, ls]	313	342	3.4
LRR [sensitive, ls]	313	342	67
LRR [sensitive, ls]	343	366	0.11
LRR [sensitive, ls]	343	366	2.1
LRR [sensitive, ls]	368	391	0.0033
LRR [sensitive, ls]	368	391	0.066
LRR [sensitive, ls]	392	415	0.00049
LRR [sensitive, ls]	392	415	0.0097
LRR [sensitive, ls]	416	439	0.019
LRR [sensitive, ls]	416	439	0.38
LRR [sensitive, ls]	440	463	2.8
LRR [sensitive, ls]	440	463	55
LRR [sensitive, ls]	464	488	0.079
LRR [sensitive, ls]	464	488	1.6
LRR [sensitive, ls]	489	512	2.2
LRR [sensitive, ls]	489	512	43
LRR [sensitive, ls]	513	536	0.013
LRR [sensitive, ls]	513	536	0.26
LRR [sensitive, ls]	537	560	0.61
LRR [sensitive, ls]	537	560	12
LRR [sensitive, ls]	561	584	0.71
LRR [sensitive, ls]	561	584	14
LRR [sensitive, ls]	585	608	0.0007
LRR [sensitive, ls]	585	608	0.014
LRR [sensitive, ls]	609	634	0.1
LRR [sensitive, ls]	609	634	2
LRR [sensitive, ls]	1073	1096	1.9
LRR [sensitive, ls]	1073	1096	37
LRR [sensitive, ls]	1097	1120	0.068
LRR [sensitive, ls]	1097	1120	1.3
LRR [sensitive, ls]	1121	1141	0.1
LRR [sensitive, ls]	1121	1141	2
LRR [sensitive, ls]	1145	1169	0.86
LRR [sensitive, ls]	1145	1169	17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	20	650	2e-92
Xa21 [O. sativa]	24	842	1e-167
CLV2 [A. thaliana]	27	624	2e-60
Cf-9 [L. pimpinellifolium]	48	616	7e-57
Cf-9 [L. pimpinellifolium]	70	654	6e-51
CLV2 [A. thaliana]	71	310	2e-14
FLS2 [A.thaliana]	71	570	4e-65
Cf-9 [L. pimpinellifolium]	74	588	4e-47
FLS2 [A.thaliana]	74	1034	1e-121
CLV2 [A. thaliana]	75	533	2e-41
CLV2 [A. thaliana]	280	626	7e-40
CLV2 [A. thaliana]	347	664	4e-35
Pto [L. esculentum]	724	1034	7e-21
Rpg1 [Hordeum vulgare]	728	944	6e-27
Rpg1 [Hordeum vulgare]	728	944	8e-19
Xa21 [O. sativa]	922	1187	3e-11
FLS2 [A.thaliana]	1003	1187	4e-14
Xa21 [O. sativa]	1038	1193	4e-23
CLV2 [A. thaliana]	1053	1196	7e-11
Xa21 [O. sativa]	1072	1215	1e-10
Xa21 [O. sativa]	1073	1299	2e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2712.m00179

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)