Report for 2712.m00183

 > 2712.m00183, length: 1042, copies: 2 

MRLLVLLSLISVLTIAGGSTDEATLPAFKAGLSSRTLTSWNSSTSFCNWEGVKCSRHRPTRVVGLSLPSSNLAGT

LPPAIGNLTFLRWFNLSSNGLHGEIPPSLGHLQHLRILDLGSNSFSGAFPDNLSSCISLINLTLGYNQLSGHIPV

KLGNTLTWLQKLHLGNNSFTGPIPASLANLSSLEFLKLDFNHLKGLIPSSLGNIPNLQKIGLDGNSLSGEFPPSI

WNLSKLTVLQVYENKLKGSIPANIGDKLPNMQHFVLSVNQFSGVIPSSLFNLSSLTDVYLDGNKFSGFVPPTVGR

LKSLVRLSLSSNRLEANNMKGWEFITSLANCSQLQQLDIAENSFIGQLPISIVNLSTTLQKFFLRGNSVSGSIPT

DIGNLIGLDTLDLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNILAAYDAHLEGPIPATLG

KLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGPIPSEVGTLVNLNSIELSGNQLSDQIPDSIGNC

EVLEYLLLDSNSFEGSIPQSLTKLKGIAILNLTMNKFSGSIPNAIGSMGNLQQLCLAHNNLSGSIPETLQNLTQL

WHLDVSFNNLQGKVPDEGAFRNLTYASVAGNDKLCGGIPRLHLAPCPIPAVRKDRKERMKYLKVAFITTGAILVL

ASAIVLIMLQHRKLKGRQNSQEISPVIEEQYQRISYYALSRGSNEFSEANLLGKGRYGSVYKCTLQDEGEPVAIK

VFDLKQLGSSRSFQAECEALRRVRHRCLTKIITCCSSIDPQGQEFKALVFEYMPNGSLDSWLHPTSSNPTPSNTL

SLSQRLSIVVDILDALDYLHNSCQPPIIHCDLKPSNILLAEDMSAKVGDFGISKILPKSTTRTLQYSKSSIGIRG

SIGYIAPEYGEGSAVTRAGDTYSLGILLLEMFNGRSPTDDIFRDSMDLHKFVAASFLESAMNIADRTIWLHEEAN

DTDGTNASTKRRIIQQCLVSVLRLGLSCSKQQPRDRMLLPDAASEIHAIRDEYLRSWMVENEQSTLN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	85	108	0.43
LRR [Pfam ls]	109	129	3.3
LRR [Pfam ls]	133	157	6.9
LRR [Pfam ls]	182	205	0.11
LRR [Pfam ls]	206	229	0.29
LRR [Pfam ls]	230	254	0.19
LRR [Pfam ls]	255	278	9.6
LRR [Pfam ls]	279	302	7.4
LRR [Pfam ls]	382	405	3.1
LRR [Pfam ls]	406	429	6.8
LRR [Pfam ls]	503	526	0.19
LRR [Pfam ls]	527	550	5.7
LRR [Pfam ls]	575	598	0.0085
LRR [Pfam ls]	599	624	0.17
Ser/Thr pkinase [Pfam fs]	721	940	3.7e-50
Ser/Thr pkinase [Pfam ls]	721	994	8.9e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	61	84	1.4
LRR [sensitive, ls]	61	84	27
LRR [sensitive, ls]	85	108	0.022
LRR [sensitive, ls]	85	108	0.43
LRR [sensitive, ls]	109	129	0.17
LRR [sensitive, ls]	109	129	3.3
LRR [sensitive, ls]	133	157	0.35
LRR [sensitive, ls]	133	157	6.9
LRR [sensitive, ls]	158	181	0.65
LRR [sensitive, ls]	158	181	13
LRR [sensitive, ls]	182	205	0.0058
LRR [sensitive, ls]	182	205	0.11
LRR [sensitive, ls]	206	229	0.015
LRR [sensitive, ls]	206	229	0.29
LRR [sensitive, ls]	230	254	0.0096
LRR [sensitive, ls]	230	254	0.19
LRR [sensitive, ls]	255	278	0.49
LRR [sensitive, ls]	255	278	9.6
LRR [sensitive, ls]	279	302	0.38
LRR [sensitive, ls]	279	302	7.4
LRR [sensitive, ls]	303	332	1.4
LRR [sensitive, ls]	303	332	27
LRR [sensitive, ls]	333	356	0.89
LRR [sensitive, ls]	333	356	18
LRR [sensitive, ls]	358	381	0.53
LRR [sensitive, ls]	358	381	10
LRR [sensitive, ls]	382	405	0.16
LRR [sensitive, ls]	382	405	3.1
LRR [sensitive, ls]	406	429	0.34
LRR [sensitive, ls]	406	429	6.8
LRR [sensitive, ls]	430	453	2.9
LRR [sensitive, ls]	430	453	56
LRR [sensitive, ls]	454	478	0.71
LRR [sensitive, ls]	454	478	14
LRR [sensitive, ls]	503	526	0.0095
LRR [sensitive, ls]	503	526	0.19
LRR [sensitive, ls]	527	550	0.29
LRR [sensitive, ls]	527	550	5.7
LRR [sensitive, ls]	551	574	4.3
LRR [sensitive, ls]	551	574	86
LRR [sensitive, ls]	575	598	0.00043
LRR [sensitive, ls]	575	598	0.0085
LRR [sensitive, ls]	599	624	0.0084
LRR [sensitive, ls]	599	624	0.17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	7	224	4e-23
CLV2 [A. thaliana]	21	634	1e-50
Xa21 [O. sativa]	21	832	1e-162
FLS2 [A.thaliana]	25	640	1e-88
Cf-9 [L. pimpinellifolium]	35	606	1e-58
Cf-9 [L. pimpinellifolium]	38	683	6e-54
FLS2 [A.thaliana]	65	1025	1e-126
FLS2 [A.thaliana]	134	641	1e-73
Rpg1 [Hordeum vulgare]	707	935	1e-29
Pto [L. esculentum]	714	936	4e-23
Rpg1 [Hordeum vulgare]	718	935	3e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	662	684	out -> in

Report for 2712.m00183

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)