Report for 2737.m00084

 > 2737.m00084, length: 1004, copies: 2 

MLLLVLLQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGH

GDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGI

GRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALV

DSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHK

KLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLK

SLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILS

LHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLD

LSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNR

FSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLR

GEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHV

AQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDI

TFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQL

ASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGL

GFGFGFALSIVVIWGIPIRKRSRVRQRAL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	105	130	2.4
LRR [Pfam ls]	131	154	9.3
LRR [Pfam ls]	230	253	2.4
LRR [Pfam ls]	254	276	0.03
LRR [Pfam ls]	301	324	8.5
LRR [Pfam ls]	325	348	9.2
LRR [Pfam ls]	397	420	0.32
LRR [Pfam ls]	421	444	4.6
LRR [Pfam ls]	497	518	8
LRR [Pfam ls]	520	544	1.1
LRR [Pfam ls]	638	662	0.94
LRR [Pfam ls]	663	683	8.6
LRR [Pfam ls]	687	710	4.1
LRR [Pfam ls]	711	734	7.8
LRR [Pfam ls]	833	856	2.5
LRR [Pfam ls]	857	880	0.67
LRR [Pfam ls]	881	904	0.14
LRR [Pfam ls]	905	928	0.074

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	104	0.91
LRR [sensitive, ls]	79	104	18
LRR [sensitive, ls]	105	130	0.12
LRR [sensitive, ls]	105	130	2.4
LRR [sensitive, ls]	131	154	0.47
LRR [sensitive, ls]	131	154	9.3
LRR [sensitive, ls]	230	253	0.12
LRR [sensitive, ls]	230	253	2.4
LRR [sensitive, ls]	254	276	0.0015
LRR [sensitive, ls]	254	276	0.03
LRR [sensitive, ls]	277	300	0.68
LRR [sensitive, ls]	277	300	13
LRR [sensitive, ls]	301	324	0.43
LRR [sensitive, ls]	301	324	8.5
LRR [sensitive, ls]	325	348	0.47
LRR [sensitive, ls]	325	348	9.2
LRR [sensitive, ls]	349	372	1.4
LRR [sensitive, ls]	349	372	28
LRR [sensitive, ls]	373	396	2.1
LRR [sensitive, ls]	373	396	41
LRR [sensitive, ls]	397	420	0.016
LRR [sensitive, ls]	397	420	0.32
LRR [sensitive, ls]	421	444	0.23
LRR [sensitive, ls]	421	444	4.6
LRR [sensitive, ls]	445	469	1.8
LRR [sensitive, ls]	445	469	36
LRR [sensitive, ls]	470	492	2
LRR [sensitive, ls]	470	492	38
LRR [sensitive, ls]	497	518	0.4
LRR [sensitive, ls]	497	518	8
LRR [sensitive, ls]	520	544	0.056
LRR [sensitive, ls]	520	544	1.1
LRR [sensitive, ls]	545	568	0.61
LRR [sensitive, ls]	545	568	12
LRR [sensitive, ls]	590	613	5.5
LRR [sensitive, ls]	590	613	110
LRR [sensitive, ls]	638	662	0.048
LRR [sensitive, ls]	638	662	0.94
LRR [sensitive, ls]	663	683	0.44
LRR [sensitive, ls]	663	683	8.6
LRR [sensitive, ls]	687	710	0.21
LRR [sensitive, ls]	687	710	4.1
LRR [sensitive, ls]	711	734	0.4
LRR [sensitive, ls]	711	734	7.8
LRR [sensitive, ls]	765	789	0.67
LRR [sensitive, ls]	765	789	13
LRR [sensitive, ls]	833	856	0.13
LRR [sensitive, ls]	833	856	2.5
LRR [sensitive, ls]	857	880	0.034
LRR [sensitive, ls]	857	880	0.67
LRR [sensitive, ls]	881	904	0.0073
LRR [sensitive, ls]	881	904	0.14
LRR [sensitive, ls]	905	928	0.0038
LRR [sensitive, ls]	905	928	0.074

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	585	2e-37
Cf-9 [L. pimpinellifolium]	31	989	1e-96
CLV2 [A. thaliana]	33	719	9e-45
FLS2 [A.thaliana]	66	798	6e-65
Xa21 [O. sativa]	79	438	4e-23
Xa21 [O. sativa]	99	474	8e-16
FLS2 [A.thaliana]	185	942	2e-73
Xa21 [O. sativa]	197	750	3e-39
Xa21 [O. sativa]	281	936	9e-41
CLV2 [A. thaliana]	328	941	1e-55
Xa21 [O. sativa]	338	942	2e-50
CLV2 [A. thaliana]	497	935	4e-33
Xa21 [O. sativa]	524	943	1e-28
CLV2 [A. thaliana]	587	957	2e-25
Xa21 [O. sativa]	834	942	3e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	971	993	out -> in

Report for 2737.m00084

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)