Report for 2737.m00099

 > 2737.m00099, length: 987, copies: 2 

MPAPCLPDQAAALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPAL

FELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFL

SVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLS

GIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSN

DILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSL

TLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFS

LNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELF

ILNLLHNKFDNIGYNYLPFYLEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNN

LSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFE

GQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASN

NFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSI

PKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDS

PQFSNNLSYLGNIGLCGFPLSKECSNMTTPPSSHPSEEKHVDVILFLFVGLGVGIGFAVIIVVTWGIRIKKRSQD

SRFPFWKKVLCM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	80	105	1.7
LRR [Pfam ls]	106	129	1.1
LRR [Pfam ls]	229	252	0.11
LRR [Pfam ls]	253	276	5.5
LRR [Pfam ls]	374	397	0.24
LRR [Pfam ls]	398	421	0.67
LRR [Pfam ls]	422	446	0.23
LRR [Pfam ls]	614	635	3
LRR [Pfam ls]	687	709	3.9
LRR [Pfam ls]	741	765	0.033
LRR [Pfam ls]	810	833	5.2
LRR [Pfam ls]	834	857	3.6
LRR [Pfam ls]	858	881	0.017

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	55	79	0.56
LRR [sensitive, ls]	55	79	11
LRR [sensitive, ls]	80	105	0.087
LRR [sensitive, ls]	80	105	1.7
LRR [sensitive, ls]	106	129	0.058
LRR [sensitive, ls]	106	129	1.1
LRR [sensitive, ls]	130	154	6.7
LRR [sensitive, ls]	130	154	130
LRR [sensitive, ls]	205	228	0.73
LRR [sensitive, ls]	205	228	14
LRR [sensitive, ls]	229	252	0.0054
LRR [sensitive, ls]	229	252	0.11
LRR [sensitive, ls]	253	276	0.28
LRR [sensitive, ls]	253	276	5.5
LRR [sensitive, ls]	277	301	1.7
LRR [sensitive, ls]	277	301	34
LRR [sensitive, ls]	326	349	5.7
LRR [sensitive, ls]	326	349	110
LRR [sensitive, ls]	350	373	1.8
LRR [sensitive, ls]	350	373	36
LRR [sensitive, ls]	374	397	0.012
LRR [sensitive, ls]	374	397	0.24
LRR [sensitive, ls]	398	421	0.034
LRR [sensitive, ls]	398	421	0.67
LRR [sensitive, ls]	422	446	0.012
LRR [sensitive, ls]	422	446	0.23
LRR [sensitive, ls]	447	468	1.4
LRR [sensitive, ls]	447	468	28
LRR [sensitive, ls]	475	497	1.1
LRR [sensitive, ls]	475	497	22
LRR [sensitive, ls]	545	566	1.8
LRR [sensitive, ls]	545	566	36
LRR [sensitive, ls]	590	613	4.5
LRR [sensitive, ls]	590	613	88
LRR [sensitive, ls]	614	635	0.15
LRR [sensitive, ls]	614	635	3
LRR [sensitive, ls]	663	686	2.4
LRR [sensitive, ls]	663	686	48
LRR [sensitive, ls]	687	709	0.2
LRR [sensitive, ls]	687	709	3.9
LRR [sensitive, ls]	711	735	1.3
LRR [sensitive, ls]	711	735	25
LRR [sensitive, ls]	741	765	0.0017
LRR [sensitive, ls]	741	765	0.033
LRR [sensitive, ls]	810	833	0.26
LRR [sensitive, ls]	810	833	5.2
LRR [sensitive, ls]	834	857	0.18
LRR [sensitive, ls]	834	857	3.6
LRR [sensitive, ls]	858	881	0.00085
LRR [sensitive, ls]	858	881	0.017
LRR [sensitive, ls]	882	904	0.56
LRR [sensitive, ls]	882	904	11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	7	676	5e-42
Xa21 [O. sativa]	12	703	3e-45
FLS2 [A.thaliana]	40	976	5e-73
CLV2 [A. thaliana]	71	629	7e-29
Xa21 [O. sativa]	74	415	2e-19
Cf-9 [L. pimpinellifolium]	129	981	3e-98
Xa21 [O. sativa]	289	875	3e-38
CLV2 [A. thaliana]	303	916	1e-54
Xa21 [O. sativa]	303	949	4e-45

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	945	967	out -> in

Report for 2737.m00099

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)