Report for 2738.m00164

 > 2738.m00164, length: 494, copies: 2 

MEDWREERWESRSDQRKGRRMGEWRTRLSQASRRRCFLPCSVAMAASICAGRRHRHQRWFRAQGRCRGGGGELLH

NLHRHRFFVRPGVEDASRRRKGCGRAALFTGMRRENCRALAANQSMRRDVDTDMGFYFWTKLPLANVIDLQYNFL

TGPVPESFNNFSSLTVLQLSSLESLLVGHTNFSGTIPSSISNLKSFKELGLDASGFFGDLPSSIDLSFNMFEGPI

PLPRDSGTVLDYSNNHFSSILPNISTQLRGTTYFKASRNNLSGTLKEEWFTRLKSMITDFGNETSVMEYEGDQKQ

IYQVTTVLTNKGSTIMMEKILRTFVFLDVSDNAFHGSIPKSMGELVLLHTLNMSHNSLTGPIPSQLGRLKQMEAL

DLSSNELSGVIPQELPSLDFLGMLNLSYNRLEGKIPESLHFSLFANSSFLGNDALCGPPLSKGCSNMTLPNVIPS

EKKSVDVMLFLFSGIGFGLGFAIAIVGAWGIPIRRRSPARQRAL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	171	194	1.5
LRR [Pfam ls]	347	370	0.86
LRR [Pfam ls]	371	394	3.4

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	139	162	0.75
LRR [sensitive, ls]	139	162	15
LRR [sensitive, ls]	171	194	0.077
LRR [sensitive, ls]	171	194	1.5
LRR [sensitive, ls]	255	279	1.9
LRR [sensitive, ls]	255	279	37
LRR [sensitive, ls]	323	346	2.4
LRR [sensitive, ls]	323	346	46
LRR [sensitive, ls]	347	370	0.044
LRR [sensitive, ls]	347	370	0.86
LRR [sensitive, ls]	371	394	0.17
LRR [sensitive, ls]	371	394	3.4
LRR [sensitive, ls]	395	415	0.53
LRR [sensitive, ls]	395	415	10

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	134	432	2e-16
CLV2 [A. thaliana]	135	431	2e-21
CLV2 [A. thaliana]	136	432	2e-19
FLS2 [A.thaliana]	136	432	4e-31
FLS2 [A.thaliana]	137	443	1e-18
Cf-9 [L. pimpinellifolium]	139	475	7e-39
CLV2 [A. thaliana]	139	414	3e-20
CLV2 [A. thaliana]	142	434	2e-17
CLV2 [A. thaliana]	142	411	1e-14
Cf-9 [L. pimpinellifolium]	143	425	1e-13
Cf-9 [L. pimpinellifolium]	143	412	5e-13
FLS2 [A.thaliana]	143	464	7e-26
Xa21 [O. sativa]	143	461	2e-21
Xa21 [O. sativa]	143	414	2e-20
Xa21 [O. sativa]	145	427	4e-13
Cf-9 [L. pimpinellifolium]	150	442	1e-13
FLS2 [A.thaliana]	150	416	7e-16
CLV2 [A. thaliana]	165	414	5e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	461	483	out -> in

Report for 2738.m00164

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)