Report for 2738.m00165

 > 2738.m00165, length: 349, copies: 1 

MTSQTKMLLMLSLLLHLLIPSSSSATYTNHTGALPPAVPCLPDQASALLQLKRSFTITDDSTAAFRSWNAGKDCC

RWEGVSCGDADGRVIWLDLGDCGLESNSLDPVLFKLTSLEYLNLGGNDFNESEIPSAGFERLSQVPVQSIGQLHS

LVSLDISFSSDLIELFDHGYLINPWQMDLPNLTALVANLSSLRSLNVIDLQYNYLTGPIPEYFANLSSLSVLQLG

YNKLEGWVSPSIFQNKKLVTIDLHRNPDLSGTLPNISADSSLESLLVGRTNFSGRIPSSISNIKSLKKLDLGASG

FSGKLPSSIGKLKSLSLLQVSGLELIGLFPPWTTNLTSLEGKYLDISLI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	113	138	0.14
LRR [Pfam ls]	194	217	0.033
LRR [Pfam ls]	290	313	7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	88	112	0.68
LRR [sensitive, ls]	88	112	13
LRR [sensitive, ls]	113	138	0.0073
LRR [sensitive, ls]	113	138	0.14
LRR [sensitive, ls]	194	217	0.0017
LRR [sensitive, ls]	194	217	0.033
LRR [sensitive, ls]	218	241	4.9
LRR [sensitive, ls]	218	241	96
LRR [sensitive, ls]	242	265	0.82
LRR [sensitive, ls]	242	265	16
LRR [sensitive, ls]	266	289	1.2
LRR [sensitive, ls]	266	289	24
LRR [sensitive, ls]	290	313	0.36
LRR [sensitive, ls]	290	313	7
LRR [sensitive, ls]	314	337	4.7
LRR [sensitive, ls]	314	337	93

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	33	327	4e-24
CLV2 [A. thaliana]	33	340	4e-19
Xa21 [O. sativa]	47	340	3e-15
FLS2 [A.thaliana]	75	339	2e-16
Xa21 [O. sativa]	75	321	2e-12
FLS2 [A.thaliana]	89	344	2e-15
Cf-9 [L. pimpinellifolium]	92	346	5e-15
Cf-9 [L. pimpinellifolium]	99	327	3e-11
FLS2 [A.thaliana]	101	330	1e-15
Xa21 [O. sativa]	101	339	3e-14
CLV2 [A. thaliana]	104	332	8e-17
FLS2 [A.thaliana]	106	330	5e-14
Cf-9 [L. pimpinellifolium]	107	321	1e-10
FLS2 [A.thaliana]	109	330	2e-11
FLS2 [A.thaliana]	131	347	1e-17
Xa21 [O. sativa]	168	344	1e-13
FLS2 [A.thaliana]	182	349	9e-13
FLS2 [A.thaliana]	184	340	3e-11
FLS2 [A.thaliana]	186	339	5e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 2738.m00165

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)