Report for 2747.m00132

 > 2747.m00132, length: 1192, copies: 2 

MAFIVWALLLFLLHLPTIATGSSAHFGGNNTVRCHPNQAAALLQLKQSFFWVNSPVILPTWQDGTDCCTWEGVGC

DASSHLVTVLDLSGRGMYSDSFEPALFSLTSLQRLDLSMNSLGTSSTTKDAEFDRLTSLTHLNLSNSGLDGQIPM

GINKLINLVSLDLSKRYVNDNSDISFNESDDEIIFTGDSYNHLQESRLMSLVENLSNLKELYLDHVDMSTNVDDW

CKTLAQSVPRLQVLSLDGCSLNTPIHHSLLRLHSLTVINLQSNPGIAVNLFPDFFMGFANLTVLRLSHNNLEGWF

PDKFFQLKNLRILDLSFNMNLLGHLPKVPTSLETLRLEGTNFSYAKRISSSNFNMLKELGLEGKLISKDFLTSFG

LIWSLCHLELLNSELLGDSGSNLLSWIGAHKNLTCLILSEFDFSSTKPSSISNFKNLRSLWLFGCNLTRPIMSAI

GDLVDLQSLDMSNCNTYSSMPSSIGNLTNLKSLYINSPGFLGPMPAAIGNLKSLKSMVFSNCEFTGPMPSTIGNL

TKLQTLEIAACRFSGPIPYSIGQLKELRALFIEGCNMSGRIPNSIVNMSKLIYLGLPANYLSGKIPARLFTLPAL

LFLDLFGNHFSGPIQEFDAVPSYLMSLQLTSNELTGEFPKSFFELTSLIALEIDLNNLAGSVDLSSFKRLKKLRD

LNLSHNNLSVIMDDEGDNSSSTYLSELKELGLACCNITKFPSILTRLSDMSYLDLSCNKISGNIPKWIWEKWSSS

VVHLNLSHNMLTSMEVASYLLPFNRHFETLDLSSNMLQGQIPIPNLSAEFLDYSHNAFSSILPNFTLYLSKTWYL

SMSKNNISGNIPHSICNSSLLVLNLAHNNFSGPFPSCLMEQTYFRNILNLRGNHFEGMLPTNVTRCAFQTIDLNG

NKIEGRLPRALGNCTYLEVLDLGNNKIADTFPSWLGSLSNLRVLVLRSNRLYGSIGYTFEDKSGDHFPNLQIIDL

ASNNFTGSLHPQWFEKFISMKKYNNTGETISHRHSISDGFYQDTVTISCKGFSMTFERILTTLTAIDLSDNALEG

SIPESVGKLVSLHVLNLSHNAFSGRIPPQIGGITALESLDLSSNWISGEIPQELTNLTFLTVLNLSNNQLEGKIP

ESRQFATFENSSYEGNAGLCGDPLPKCASWSPPSAEPHVESSSEHVDIVMFLFVGVGFGVGFAVAVQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	133	156	9.3
LRR [Pfam ls]	235	258	2.4
LRR [Pfam ls]	285	308	0.94
LRR [Pfam ls]	431	454	2.5
LRR [Pfam ls]	503	526	7.7
LRR [Pfam ls]	527	550	6.6
LRR [Pfam ls]	672	695	0.22
LRR [Pfam ls]	701	723	2.3
LRR [Pfam ls]	724	748	7
LRR [Pfam ls]	750	772	4.1
LRR [Pfam ls]	776	797	4.3
LRR [Pfam ls]	892	915	1.4
LRR [Pfam ls]	916	939	0.3
LRR [Pfam ls]	969	993	0.12
LRR [Pfam ls]	1037	1060	0.43
LRR [Pfam ls]	1061	1084	0.041
LRR [Pfam ls]	1085	1108	0.0088
LRR [Pfam ls]	1109	1131	0.34

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	81	105	7.3
LRR [sensitive, ls]	81	105	140
LRR [sensitive, ls]	106	132	1.7
LRR [sensitive, ls]	106	132	33
LRR [sensitive, ls]	133	156	0.47
LRR [sensitive, ls]	133	156	9.3
LRR [sensitive, ls]	207	230	2.5
LRR [sensitive, ls]	207	230	50
LRR [sensitive, ls]	235	258	0.12
LRR [sensitive, ls]	235	258	2.4
LRR [sensitive, ls]	259	284	1.4
LRR [sensitive, ls]	259	284	28
LRR [sensitive, ls]	285	308	0.048
LRR [sensitive, ls]	285	308	0.94
LRR [sensitive, ls]	309	330	0.56
LRR [sensitive, ls]	309	330	11
LRR [sensitive, ls]	331	357	1
LRR [sensitive, ls]	331	357	20
LRR [sensitive, ls]	431	454	0.13
LRR [sensitive, ls]	431	454	2.5
LRR [sensitive, ls]	455	478	2.5
LRR [sensitive, ls]	455	478	49
LRR [sensitive, ls]	503	526	0.39
LRR [sensitive, ls]	503	526	7.7
LRR [sensitive, ls]	527	550	0.33
LRR [sensitive, ls]	527	550	6.6
LRR [sensitive, ls]	551	574	0.91
LRR [sensitive, ls]	551	574	18
LRR [sensitive, ls]	575	598	1.7
LRR [sensitive, ls]	575	598	33
LRR [sensitive, ls]	599	621	1.1
LRR [sensitive, ls]	599	621	21
LRR [sensitive, ls]	623	646	0.87
LRR [sensitive, ls]	623	646	17
LRR [sensitive, ls]	647	671	2.5
LRR [sensitive, ls]	647	671	50
LRR [sensitive, ls]	672	695	0.011
LRR [sensitive, ls]	672	695	0.22
LRR [sensitive, ls]	701	723	0.12
LRR [sensitive, ls]	701	723	2.3
LRR [sensitive, ls]	724	748	0.36
LRR [sensitive, ls]	724	748	7
LRR [sensitive, ls]	750	772	0.21
LRR [sensitive, ls]	750	772	4.1
LRR [sensitive, ls]	776	797	0.22
LRR [sensitive, ls]	776	797	4.3
LRR [sensitive, ls]	844	867	0.92
LRR [sensitive, ls]	844	867	18
LRR [sensitive, ls]	892	915	0.069
LRR [sensitive, ls]	892	915	1.4
LRR [sensitive, ls]	916	939	0.015
LRR [sensitive, ls]	916	939	0.3
LRR [sensitive, ls]	940	968	1.1
LRR [sensitive, ls]	940	968	21
LRR [sensitive, ls]	969	993	0.0063
LRR [sensitive, ls]	969	993	0.12
LRR [sensitive, ls]	1037	1060	0.022
LRR [sensitive, ls]	1037	1060	0.43
LRR [sensitive, ls]	1061	1084	0.0021
LRR [sensitive, ls]	1061	1084	0.041
LRR [sensitive, ls]	1085	1108	0.00045
LRR [sensitive, ls]	1085	1108	0.0088
LRR [sensitive, ls]	1109	1131	0.017
LRR [sensitive, ls]	1109	1131	0.34

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	8	639	6e-32
Cf-9 [L. pimpinellifolium]	34	901	5e-47
FLS2 [A.thaliana]	68	878	3e-58
CLV2 [A. thaliana]	239	812	2e-41
Xa21 [O. sativa]	383	901	5e-34
CLV2 [A. thaliana]	434	1152	4e-52
Xa21 [O. sativa]	435	955	8e-45
FLS2 [A.thaliana]	449	1152	1e-68
FLS2 [A.thaliana]	461	1129	5e-56
Cf-9 [L. pimpinellifolium]	472	1191	1e-99
CLV2 [A. thaliana]	575	1108	6e-33
Xa21 [O. sativa]	575	1153	6e-43
Xa21 [O. sativa]	1035	1149	2e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	1173	1191	out -> in

Report for 2747.m00132

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)