Report for 2770.m00135

 > 2770.m00135, length: 1002, copies: 1 

MGSGSLLLSLLLVLVVVNVGVAVNQDGLSLLDARRALAAPDGALADWNARDATPCSWTGVSCDAGVGGGAVTGIS

LAGLNLTGSFPAALCRLPRVASIDLSYNYIGPNLSSDAVAPCKALRRLDLSMNALVGPLPDALAALPELVYLKLD

SNNFSGPIPESFGRFKKLESLSLVYNLLGGEVPPFLGGVSTLRELNLSYNPFVAGPVPAELGNLSALRVLWLAGC

NLIGAIPASLGRLGNLTDLDLSTNALTGSIPPEITRLTSVVQIELYNNSLTGPIPVGFGKLAELQGVDLAMNRLN

GAIPDDFFEAPKLESVHLYANSLTGPVPESVAKAASLVELRLFANRLNGTLPADLGKNSPLVCVDMSDNSISGEI

PPAICDRGELEELLMLDNKLSGRIPDGLGRCRRLRRVRLSNNRLDGDVPAAVWGLPHMSLLELNDNQLTGVISPV

IGGAANLSKLVLSNNRLTGSIPPEIGSASKLYELSADGNMLSGPLPGSLGGLEELGRLVLRNNSLSGQLLRGINS

WKKLSELNLADNGFTGAIPAELGDLPVLNYLDLSGNRLTGEVPMQLENLKLNQFNVSNNQLSGALPPQYATAAYR

SSFLGNPGLCGDNAGLCANSQGGPRSRAGFAWMMRSIFIFAAVVLVAGVAWFYWRYRSFNNSKLSADRSKWSLTS

FHKLSFSEYEILDCLDEDNVIGSGASGKVYKAVLSNGEVVAVKKLWGLKKGTDVENGGEGSTADNSFEAEVKTLG

KIRHKNIVKLWCSCTHNDTKLLVYEYMPNGSLGDVLHSSKAGLLDWSTRYKIALDAAEGLSYLHHDYVPAIVHRD

VKSNNILLDAEFGARVADFGVAKVVEATVRGPKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVLLELVTGK

PPVDPEFGEKDLVKWVCSTIDQKGVEHVLDSKLDMTFKDEINRVLNIALLCSSSLPINRPAMRRVVKMLQEVRAE

ATRPRLEKDGKLSPYYYEDTSDQGSSV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	142	3
LRR [Pfam ls]	143	166	0.26
LRR [Pfam ls]	167	190	7.8
LRR [Pfam ls]	191	215	0.65
LRR [Pfam ls]	216	239	9.8
LRR [Pfam ls]	240	263	0.017
LRR [Pfam ls]	264	287	3
LRR [Pfam ls]	336	359	9.3
LRR [Pfam ls]	408	431	1.1
LRR [Pfam ls]	456	479	0.061
LRR [Pfam ls]	480	503	5.1
LRR [Pfam ls]	528	551	0.12
LRR [Pfam ls]	552	575	0.32
Ser/Thr pkinase [Pfam fs]	690	902	1.3e-45
Ser/Thr pkinase [Pfam ls]	690	971	3.1e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	70	93	3.4
LRR [sensitive, ls]	70	93	67
LRR [sensitive, ls]	94	118	0.92
LRR [sensitive, ls]	94	118	18
LRR [sensitive, ls]	119	142	0.15
LRR [sensitive, ls]	119	142	3
LRR [sensitive, ls]	143	166	0.013
LRR [sensitive, ls]	143	166	0.26
LRR [sensitive, ls]	167	190	0.4
LRR [sensitive, ls]	167	190	7.8
LRR [sensitive, ls]	191	215	0.033
LRR [sensitive, ls]	191	215	0.65
LRR [sensitive, ls]	216	239	0.5
LRR [sensitive, ls]	216	239	9.8
LRR [sensitive, ls]	240	263	0.00085
LRR [sensitive, ls]	240	263	0.017
LRR [sensitive, ls]	264	287	0.15
LRR [sensitive, ls]	264	287	3
LRR [sensitive, ls]	288	311	6.4
LRR [sensitive, ls]	288	311	130
LRR [sensitive, ls]	312	335	0.61
LRR [sensitive, ls]	312	335	12
LRR [sensitive, ls]	336	359	0.47
LRR [sensitive, ls]	336	359	9.3
LRR [sensitive, ls]	360	383	4.3
LRR [sensitive, ls]	360	383	84
LRR [sensitive, ls]	384	407	2
LRR [sensitive, ls]	384	407	38
LRR [sensitive, ls]	408	431	0.058
LRR [sensitive, ls]	408	431	1.1
LRR [sensitive, ls]	432	455	0.77
LRR [sensitive, ls]	432	455	15
LRR [sensitive, ls]	456	479	0.0031
LRR [sensitive, ls]	456	479	0.061
LRR [sensitive, ls]	480	503	0.26
LRR [sensitive, ls]	480	503	5.1
LRR [sensitive, ls]	504	527	4.9
LRR [sensitive, ls]	504	527	96
LRR [sensitive, ls]	528	551	0.006
LRR [sensitive, ls]	528	551	0.12
LRR [sensitive, ls]	552	575	0.016
LRR [sensitive, ls]	552	575	0.32

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	25	615	2e-56
Xa21 [O. sativa]	26	787	5e-76
FLS2 [A.thaliana]	40	595	3e-68
Cf-9 [L. pimpinellifolium]	47	571	1e-51
Cf-9 [L. pimpinellifolium]	68	329	4e-15
FLS2 [A.thaliana]	70	256	2e-19
Cf-9 [L. pimpinellifolium]	71	611	7e-47
FLS2 [A.thaliana]	71	984	1e-116
FLS2 [A.thaliana]	81	593	1e-67
Cf-9 [L. pimpinellifolium]	209	590	7e-31
Pto [L. esculentum]	685	970	3e-34
Rpg1 [Hordeum vulgare]	686	972	2e-36
Rpg1 [Hordeum vulgare]	686	972	3e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	632	654	out -> in

Report for 2770.m00135

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)